Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4TEN1

Protein Details
Accession G4TEN1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26ATQNSAKSKGKSKSRWRFLRYAIRPHydrophilic
NLS Segment(s)
PositionSequence
10-18KGKSKSRWR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MATQNSAKSKGKSKSRWRFLRYAIRPSSKKHQMQNTDSIAPDVVINVVEASDILVPLKEARRTTKSIIDLKQALNDNQGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.87
4 0.84
5 0.82
6 0.8
7 0.81
8 0.76
9 0.75
10 0.71
11 0.7
12 0.66
13 0.64
14 0.65
15 0.64
16 0.64
17 0.61
18 0.62
19 0.62
20 0.63
21 0.65
22 0.59
23 0.51
24 0.45
25 0.38
26 0.29
27 0.21
28 0.17
29 0.09
30 0.06
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.07
44 0.11
45 0.14
46 0.17
47 0.23
48 0.28
49 0.33
50 0.37
51 0.42
52 0.45
53 0.49
54 0.5
55 0.51
56 0.5
57 0.47
58 0.5
59 0.46
60 0.4