Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C2SCS6

Protein Details
Accession A0A5C2SCS6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30ACRVTLCHPRLRRRAQRRVLRSRRVLSPCHydrophilic
NLS Segment(s)
PositionSequence
14-18RRAQR
Subcellular Location(s) mito 24, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
Amino Acid Sequences MACRVTLCHPRLRRRAQRRVLRSRRVLSPCLPVVLPSRTARIELGILVTAYFFSPTALGLRALAIPVSSPNLIVTVRSSRSSSVLSHHISVRTCQARRRPVLTSDLAPYYNQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.88
4 0.9
5 0.9
6 0.92
7 0.91
8 0.9
9 0.88
10 0.82
11 0.81
12 0.75
13 0.69
14 0.61
15 0.58
16 0.49
17 0.42
18 0.37
19 0.29
20 0.28
21 0.26
22 0.26
23 0.2
24 0.22
25 0.2
26 0.22
27 0.2
28 0.17
29 0.15
30 0.11
31 0.11
32 0.08
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.1
62 0.12
63 0.14
64 0.16
65 0.17
66 0.17
67 0.19
68 0.21
69 0.19
70 0.19
71 0.23
72 0.24
73 0.25
74 0.27
75 0.28
76 0.27
77 0.28
78 0.32
79 0.35
80 0.35
81 0.4
82 0.47
83 0.53
84 0.58
85 0.61
86 0.57
87 0.53
88 0.57
89 0.54
90 0.48
91 0.43
92 0.4
93 0.37