Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TWW4

Protein Details
Accession G4TWW4   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRGCRVSSPGRPHCCRRRPTLTPTKPTSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
CDD cd02961  PDI_a_family  
Amino Acid Sequences MRGCRVSSPGRPHCCRRRPTLTPTKPTSFLPEGPVLQTLKAADFASPTEHGTWHIEFTSPDGGYSRNFEPTREKLGESHKSNSAGISLALVGCIQSRGLCRDKIVGWYSLLRLYHNNADGTVTKYEFNDDRSLENLLKWLDRNTRHGTSLLDQVDEKQSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.78
5 0.76
6 0.8
7 0.81
8 0.8
9 0.8
10 0.8
11 0.76
12 0.68
13 0.62
14 0.59
15 0.52
16 0.44
17 0.4
18 0.36
19 0.32
20 0.3
21 0.32
22 0.25
23 0.2
24 0.2
25 0.15
26 0.12
27 0.13
28 0.12
29 0.09
30 0.1
31 0.1
32 0.12
33 0.12
34 0.13
35 0.12
36 0.12
37 0.13
38 0.16
39 0.16
40 0.14
41 0.13
42 0.13
43 0.12
44 0.14
45 0.16
46 0.13
47 0.12
48 0.12
49 0.12
50 0.12
51 0.16
52 0.15
53 0.18
54 0.18
55 0.2
56 0.25
57 0.27
58 0.33
59 0.31
60 0.31
61 0.26
62 0.34
63 0.41
64 0.38
65 0.38
66 0.34
67 0.34
68 0.33
69 0.3
70 0.23
71 0.15
72 0.11
73 0.09
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.03
80 0.04
81 0.03
82 0.05
83 0.06
84 0.11
85 0.14
86 0.14
87 0.15
88 0.18
89 0.19
90 0.23
91 0.24
92 0.21
93 0.19
94 0.2
95 0.2
96 0.21
97 0.2
98 0.16
99 0.16
100 0.18
101 0.21
102 0.22
103 0.21
104 0.19
105 0.21
106 0.21
107 0.22
108 0.21
109 0.17
110 0.16
111 0.16
112 0.2
113 0.19
114 0.21
115 0.22
116 0.21
117 0.22
118 0.23
119 0.26
120 0.23
121 0.22
122 0.22
123 0.19
124 0.2
125 0.2
126 0.24
127 0.29
128 0.32
129 0.39
130 0.43
131 0.45
132 0.45
133 0.45
134 0.43
135 0.38
136 0.42
137 0.36
138 0.3
139 0.27
140 0.28