Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C2RNS6

Protein Details
Accession A0A5C2RNS6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-95DGYGIRKREKKRVRSGHLELRAABasic
NLS Segment(s)
PositionSequence
78-86RKREKKRVR
Subcellular Location(s) extr 10, mito 7, golg 5, nucl 1, plas 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRIPFFLFFGPAYAYLVASTVLKQLLLTLISLLSSPMNAPNGSTNTTSPQPTQAQRELDQLWAKLEAKDLIPDGYGIRKREKKRVRSGHLELRAAQTTKTPSTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.1
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.08
13 0.08
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.08
25 0.08
26 0.09
27 0.11
28 0.13
29 0.15
30 0.16
31 0.15
32 0.16
33 0.18
34 0.19
35 0.16
36 0.19
37 0.2
38 0.22
39 0.26
40 0.27
41 0.28
42 0.28
43 0.31
44 0.28
45 0.27
46 0.26
47 0.22
48 0.19
49 0.18
50 0.17
51 0.14
52 0.15
53 0.13
54 0.11
55 0.12
56 0.12
57 0.1
58 0.1
59 0.1
60 0.09
61 0.15
62 0.19
63 0.2
64 0.29
65 0.37
66 0.42
67 0.52
68 0.61
69 0.64
70 0.71
71 0.8
72 0.79
73 0.8
74 0.84
75 0.83
76 0.81
77 0.74
78 0.64
79 0.59
80 0.56
81 0.47
82 0.39
83 0.34
84 0.32
85 0.32