Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FKV8

Protein Details
Accession A0A5C5FKV8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-108PLDLRAKKTRAIRRRLTKVRPSSCVSHydrophilic
NLS Segment(s)
PositionSequence
78-101KGKKLPLDLRAKKTRAIRRRLTKV
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSQTLKVRASELQAKKRDELVKQLDELKTELVSLRVQKVAGGNASKLARISTVRKSIARVLTVINQKTRANLRELYKGKKLPLDLRAKKTRAIRRRLTKVRPSSCVSRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.54
4 0.59
5 0.58
6 0.51
7 0.52
8 0.5
9 0.46
10 0.45
11 0.48
12 0.42
13 0.38
14 0.36
15 0.27
16 0.19
17 0.17
18 0.15
19 0.11
20 0.12
21 0.13
22 0.14
23 0.14
24 0.14
25 0.15
26 0.16
27 0.16
28 0.16
29 0.15
30 0.13
31 0.16
32 0.16
33 0.15
34 0.14
35 0.12
36 0.11
37 0.13
38 0.16
39 0.18
40 0.23
41 0.25
42 0.25
43 0.27
44 0.3
45 0.3
46 0.27
47 0.23
48 0.19
49 0.23
50 0.28
51 0.28
52 0.25
53 0.25
54 0.25
55 0.28
56 0.31
57 0.27
58 0.25
59 0.29
60 0.3
61 0.37
62 0.41
63 0.44
64 0.46
65 0.47
66 0.45
67 0.44
68 0.44
69 0.41
70 0.46
71 0.51
72 0.52
73 0.58
74 0.65
75 0.63
76 0.65
77 0.68
78 0.69
79 0.68
80 0.69
81 0.71
82 0.72
83 0.82
84 0.86
85 0.87
86 0.87
87 0.88
88 0.86
89 0.82
90 0.77
91 0.75