FuNGI

A0A5C5FYJ1

Protein Details

Accession

A0A5C5FYJ1

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
115-143	LGKGKGKGGRKGKGKKKEPKVKTPFKVWS	Basic
401-421	DDGKDRPRPTHPRKDYVRVLV	Basic

NLS Segment(s)

Position	Sequence
116-136	GKGKGKGGRKGKGKKKEPKVK

Subcellular Location(s)

cyto 15, cyto_nucl 9, pero 5, mito 3, extr 3

Family & Domain DBs

InterPro	View protein in InterPro IPR000560 His_Pase_clade-2 IPR029033 His_PPase_superfam IPR016274 Histidine_acid_Pase_euk
Gene Ontology	GO:0016791 F:phosphatase activity
Pfam	View protein in Pfam PF00328 His_Phos_2
CDD	cd07061 HP_HAP_like

Amino Acid Sequences

MSGISPYHDAPNADITPPAGCKVAAAAFLIRHGSIYANDDEYDDYMEPFISRVVDAQNRGVAIPDSSHLAFLSTWRSAVNESNLEMITEPGKRDAYEFGKRFRDLYGDLMPPVHLGKGKGKGGRKGKGKKKEPKVKTPFKVWSASSERDVETSKAWVRGAFPHWQAGKGGGKGEGDGKFIQLVAVKNKDPDWAHSLTPHKICDAFTKEAGKPEAQQWLDTWGPPVLDRLNADAPGFDFELNDVVAMMMLCGYETVIEGSKAPASPFCSPDLFKPDEFRQFGYWNDLKYHHMVGYGSPVAPYLGLPPPTSPPDATHTQLLYAYFTHREEPPVVLTALGLWNTSTEDLPPTAMPKDRLWKTSHLLPFLGHIAIERLHCEADNSDNNDGAPGPHGLVRALFGNDDGKDRPRPTHPRKDYVRVLVNGAPQQLPTCHDGPGGTCRLADFETFVRQRTEEFSDFEGACKKEGDE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.22
3	0.22
4	0.23
5	0.22
6	0.15
7	0.13
8	0.13
9	0.15
10	0.17
11	0.15
12	0.15
13	0.16
14	0.15
15	0.17
16	0.19
17	0.15
18	0.14
19	0.13
20	0.13
21	0.12
22	0.16
23	0.17
24	0.17
25	0.17
26	0.18
27	0.18
28	0.18
29	0.19
30	0.15
31	0.13
32	0.12
33	0.12
34	0.11
35	0.1
36	0.11
37	0.08
38	0.08
39	0.1
40	0.16
41	0.2
42	0.23
43	0.25
44	0.26
45	0.25
46	0.25
47	0.25
48	0.19
49	0.15
50	0.14
51	0.12
52	0.14
53	0.14
54	0.14
55	0.12
56	0.13
57	0.12
58	0.13
59	0.17
60	0.14
61	0.14
62	0.14
63	0.15
64	0.16
65	0.2
66	0.23
67	0.2
68	0.21
69	0.23
70	0.23
71	0.22
72	0.2
73	0.17
74	0.14
75	0.14
76	0.14
77	0.15
78	0.16
79	0.16
80	0.17
81	0.22
82	0.26
83	0.34
84	0.37
85	0.4
86	0.45
87	0.46
88	0.45
89	0.4
90	0.37
91	0.29
92	0.31
93	0.3
94	0.25
95	0.25
96	0.25
97	0.23
98	0.2
99	0.19
100	0.15
101	0.11
102	0.12
103	0.18
104	0.24
105	0.3
106	0.35
107	0.4
108	0.47
109	0.54
110	0.59
111	0.64
112	0.67
113	0.72
114	0.77
115	0.82
116	0.84
117	0.86
118	0.89
119	0.87
120	0.88
121	0.89
122	0.88
123	0.84
124	0.82
125	0.78
126	0.71
127	0.68
128	0.57
129	0.55
130	0.51
131	0.48
132	0.42
133	0.37
134	0.33
135	0.3
136	0.31
137	0.24
138	0.18
139	0.2
140	0.19
141	0.19
142	0.19
143	0.18
144	0.18
145	0.22
146	0.24
147	0.26
148	0.24
149	0.29
150	0.29
151	0.29
152	0.27
153	0.27
154	0.27
155	0.22
156	0.22
157	0.17
158	0.17
159	0.16
160	0.21
161	0.17
162	0.16
163	0.15
164	0.14
165	0.13
166	0.13
167	0.13
168	0.11
169	0.12
170	0.15
171	0.18
172	0.18
173	0.19
174	0.2
175	0.24
176	0.22
177	0.23
178	0.23
179	0.22
180	0.22
181	0.26
182	0.29
183	0.29
184	0.31
185	0.28
186	0.24
187	0.22
188	0.23
189	0.24
190	0.27
191	0.24
192	0.24
193	0.28
194	0.28
195	0.31
196	0.31
197	0.26
198	0.21
199	0.21
200	0.26
201	0.22
202	0.21
203	0.18
204	0.21
205	0.2
206	0.19
207	0.18
208	0.11
209	0.11
210	0.11
211	0.12
212	0.08
213	0.09
214	0.09
215	0.11
216	0.12
217	0.12
218	0.12
219	0.1
220	0.1
221	0.11
222	0.11
223	0.07
224	0.06
225	0.06
226	0.06
227	0.06
228	0.06
229	0.04
230	0.03
231	0.03
232	0.03
233	0.03
234	0.02
235	0.02
236	0.02
237	0.02
238	0.02
239	0.02
240	0.03
241	0.03
242	0.04
243	0.04
244	0.05
245	0.05
246	0.07
247	0.07
248	0.07
249	0.08
250	0.12
251	0.14
252	0.16
253	0.17
254	0.18
255	0.18
256	0.21
257	0.26
258	0.24
259	0.22
260	0.25
261	0.27
262	0.33
263	0.33
264	0.32
265	0.29
266	0.28
267	0.28
268	0.31
269	0.29
270	0.23
271	0.24
272	0.24
273	0.23
274	0.24
275	0.25
276	0.17
277	0.16
278	0.15
279	0.13
280	0.16
281	0.15
282	0.13
283	0.12
284	0.11
285	0.1
286	0.1
287	0.1
288	0.08
289	0.11
290	0.12
291	0.12
292	0.14
293	0.17
294	0.19
295	0.21
296	0.18
297	0.17
298	0.21
299	0.24
300	0.24
301	0.24
302	0.22
303	0.21
304	0.22
305	0.2
306	0.16
307	0.13
308	0.13
309	0.13
310	0.14
311	0.15
312	0.15
313	0.17
314	0.17
315	0.18
316	0.18
317	0.18
318	0.17
319	0.14
320	0.13
321	0.12
322	0.12
323	0.1
324	0.08
325	0.06
326	0.07
327	0.08
328	0.09
329	0.08
330	0.07
331	0.09
332	0.09
333	0.1
334	0.1
335	0.12
336	0.13
337	0.17
338	0.19
339	0.21
340	0.31
341	0.33
342	0.37
343	0.38
344	0.41
345	0.43
346	0.48
347	0.49
348	0.42
349	0.38
350	0.35
351	0.33
352	0.3
353	0.25
354	0.16
355	0.12
356	0.11
357	0.12
358	0.13
359	0.12
360	0.11
361	0.11
362	0.12
363	0.13
364	0.12
365	0.17
366	0.23
367	0.26
368	0.26
369	0.26
370	0.25
371	0.25
372	0.23
373	0.17
374	0.13
375	0.1
376	0.1
377	0.11
378	0.12
379	0.11
380	0.11
381	0.12
382	0.13
383	0.13
384	0.12
385	0.11
386	0.14
387	0.14
388	0.17
389	0.19
390	0.21
391	0.28
392	0.3
393	0.34
394	0.41
395	0.51
396	0.58
397	0.67
398	0.7
399	0.73
400	0.79
401	0.83
402	0.81
403	0.79
404	0.77
405	0.68
406	0.64
407	0.58
408	0.55
409	0.49
410	0.43
411	0.35
412	0.27
413	0.27
414	0.24
415	0.23
416	0.23
417	0.21
418	0.19
419	0.2
420	0.2
421	0.21
422	0.27
423	0.28
424	0.24
425	0.23
426	0.22
427	0.24
428	0.24
429	0.22
430	0.18
431	0.16
432	0.26
433	0.27
434	0.29
435	0.29
436	0.28
437	0.3
438	0.32
439	0.37
440	0.3
441	0.31
442	0.33
443	0.36
444	0.35
445	0.36
446	0.37
447	0.31
448	0.29

A0A5C5FYJ1

3D AlphaFold-predicted Structure Viewer