Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G0M6

Protein Details
Accession A0A5C5G0M6   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPATSPATPKRPRPRPPPTSRPSVVHydrophilic
NLS Segment(s)
PositionSequence
11-15RPRPR
Subcellular Location(s) cyto 2, mito 22, nucl 1, pero 1, plas 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MPATSPATPKRPRPRPPPTSRPSVVANVLKWTLLALVTSAALSRALTETWLWGYEGRWSNERKIRDALFPPTPLVLSEAQLALHDGSQPDKYPLYLAVDGDVYDISDGGMRNYGPGKPYSVFAGRDAIRAFATGCFESHLTHDLRGLTRAQLDTVKHWKRFYANH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.9
4 0.9
5 0.85
6 0.84
7 0.77
8 0.7
9 0.63
10 0.57
11 0.54
12 0.47
13 0.42
14 0.36
15 0.34
16 0.3
17 0.26
18 0.21
19 0.15
20 0.1
21 0.09
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.09
41 0.15
42 0.2
43 0.21
44 0.25
45 0.26
46 0.33
47 0.38
48 0.4
49 0.35
50 0.35
51 0.35
52 0.36
53 0.37
54 0.35
55 0.32
56 0.31
57 0.28
58 0.24
59 0.22
60 0.17
61 0.16
62 0.11
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.08
76 0.09
77 0.09
78 0.08
79 0.08
80 0.09
81 0.12
82 0.12
83 0.11
84 0.11
85 0.11
86 0.1
87 0.1
88 0.09
89 0.05
90 0.04
91 0.04
92 0.03
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.08
99 0.09
100 0.11
101 0.11
102 0.12
103 0.15
104 0.14
105 0.15
106 0.18
107 0.21
108 0.21
109 0.2
110 0.26
111 0.23
112 0.26
113 0.25
114 0.22
115 0.18
116 0.18
117 0.17
118 0.12
119 0.15
120 0.13
121 0.12
122 0.13
123 0.14
124 0.14
125 0.15
126 0.19
127 0.17
128 0.17
129 0.19
130 0.2
131 0.21
132 0.22
133 0.21
134 0.19
135 0.22
136 0.22
137 0.21
138 0.23
139 0.24
140 0.29
141 0.39
142 0.45
143 0.46
144 0.46
145 0.49