Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G0A0

Protein Details
Accession A0A5C5G0A0   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
380-409AKPLFLTKKELKKKRRLRRQADMQDKRDRQBasic
NLS Segment(s)
PositionSequence
387-399KKELKKKRRLRRQ
Subcellular Location(s) cyto 4.5, cyto_nucl 13, nucl 20.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013881  Pre-mRNA_splic_Prp3_dom  
IPR027104  Prp3  
IPR010541  Prp3_C  
Gene Ontology GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF06544  DUF1115  
PF08572  PRP3  
Amino Acid Sequences MSDRKRPNVLGDGDRDGSSRDAKKPRANAPAAPSFLPTPMSSLPPRPAGSASPAGASGAAIDIAAKRAEIQAKLAAMKAAAAGGGISAPVPAAAAAPPAQAPPSAALPQRPLGAVPGLPTPNIDGELAAKIAEAKRKVAEMAARSQAAQQEKVNPYLSSSFQKNKTDPALDPSIAGRGGLGMAAHPLLMDTGSSTPAGASSKKDRYKPMAPKFSTTRANARMPAAPARPATPVASTSDTSAEALKESAFFDERLGYGSAGVTGKSHMGKGRQRTTFAFKQPGTFVRKGEAIRAEARLEDLKRRIYESSQKAGLQSDLEDTAKKVRRPPPPDVEWWDEGFVPDKDYDAYSTEFLDRSPLITHLVQHPISIPAPQDKIQVEAKPLFLTKKELKKKRRLRRQADMQDKRDRQKMGLLPPDPPKVKISNMMRVLTQEAIADPTKVEAQVRREMVARERKHLKENAERALTAEERREKRELEYAKDESKGIHAVAFKVRYLSDPSHKFKVKKNAIDLHLTGRICHNPKFCLVVVEGGAKSIKKYRQLMLHRIRWTEEAAPRADPSAGGADEVPKLEDHGGILRPAGPFTAPDEPEAPPSLADNTCVEVWAGAEREHLFGDIRNANCPSEASAREALGKLAHLWDVAKAAGTVEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.34
4 0.3
5 0.32
6 0.32
7 0.36
8 0.43
9 0.51
10 0.58
11 0.65
12 0.71
13 0.73
14 0.72
15 0.69
16 0.68
17 0.67
18 0.62
19 0.55
20 0.48
21 0.39
22 0.36
23 0.32
24 0.24
25 0.21
26 0.2
27 0.25
28 0.26
29 0.3
30 0.33
31 0.37
32 0.38
33 0.35
34 0.36
35 0.33
36 0.35
37 0.35
38 0.31
39 0.26
40 0.25
41 0.23
42 0.21
43 0.18
44 0.12
45 0.07
46 0.06
47 0.05
48 0.05
49 0.06
50 0.08
51 0.08
52 0.07
53 0.08
54 0.13
55 0.17
56 0.17
57 0.2
58 0.22
59 0.24
60 0.25
61 0.25
62 0.21
63 0.17
64 0.16
65 0.13
66 0.09
67 0.07
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.09
88 0.1
89 0.11
90 0.14
91 0.17
92 0.19
93 0.21
94 0.24
95 0.26
96 0.26
97 0.24
98 0.21
99 0.19
100 0.19
101 0.17
102 0.15
103 0.18
104 0.17
105 0.17
106 0.17
107 0.17
108 0.15
109 0.16
110 0.15
111 0.09
112 0.1
113 0.11
114 0.11
115 0.09
116 0.08
117 0.1
118 0.13
119 0.18
120 0.18
121 0.2
122 0.21
123 0.22
124 0.23
125 0.23
126 0.26
127 0.23
128 0.28
129 0.3
130 0.29
131 0.28
132 0.3
133 0.31
134 0.29
135 0.28
136 0.25
137 0.29
138 0.31
139 0.34
140 0.34
141 0.29
142 0.29
143 0.29
144 0.3
145 0.26
146 0.29
147 0.33
148 0.37
149 0.43
150 0.42
151 0.45
152 0.47
153 0.46
154 0.41
155 0.4
156 0.39
157 0.33
158 0.32
159 0.27
160 0.24
161 0.2
162 0.18
163 0.12
164 0.07
165 0.07
166 0.06
167 0.06
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.09
185 0.09
186 0.13
187 0.19
188 0.29
189 0.34
190 0.38
191 0.43
192 0.48
193 0.57
194 0.64
195 0.66
196 0.68
197 0.64
198 0.66
199 0.65
200 0.64
201 0.61
202 0.53
203 0.51
204 0.46
205 0.48
206 0.44
207 0.42
208 0.39
209 0.35
210 0.37
211 0.31
212 0.28
213 0.25
214 0.25
215 0.24
216 0.22
217 0.21
218 0.16
219 0.16
220 0.16
221 0.18
222 0.17
223 0.16
224 0.16
225 0.15
226 0.14
227 0.14
228 0.11
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.08
235 0.08
236 0.09
237 0.09
238 0.09
239 0.09
240 0.11
241 0.11
242 0.09
243 0.09
244 0.08
245 0.09
246 0.09
247 0.09
248 0.07
249 0.06
250 0.08
251 0.09
252 0.1
253 0.11
254 0.17
255 0.23
256 0.31
257 0.38
258 0.39
259 0.41
260 0.43
261 0.48
262 0.49
263 0.49
264 0.48
265 0.4
266 0.4
267 0.39
268 0.42
269 0.42
270 0.37
271 0.32
272 0.27
273 0.3
274 0.28
275 0.3
276 0.26
277 0.21
278 0.21
279 0.22
280 0.2
281 0.17
282 0.18
283 0.17
284 0.16
285 0.18
286 0.19
287 0.21
288 0.21
289 0.23
290 0.23
291 0.23
292 0.31
293 0.32
294 0.33
295 0.32
296 0.32
297 0.31
298 0.3
299 0.27
300 0.18
301 0.13
302 0.1
303 0.09
304 0.09
305 0.08
306 0.08
307 0.15
308 0.19
309 0.2
310 0.27
311 0.34
312 0.42
313 0.48
314 0.55
315 0.55
316 0.55
317 0.58
318 0.57
319 0.53
320 0.46
321 0.41
322 0.34
323 0.26
324 0.22
325 0.2
326 0.14
327 0.11
328 0.09
329 0.09
330 0.08
331 0.09
332 0.09
333 0.09
334 0.1
335 0.09
336 0.1
337 0.1
338 0.1
339 0.09
340 0.11
341 0.09
342 0.09
343 0.09
344 0.09
345 0.11
346 0.11
347 0.13
348 0.14
349 0.18
350 0.17
351 0.17
352 0.17
353 0.16
354 0.16
355 0.15
356 0.13
357 0.12
358 0.14
359 0.15
360 0.18
361 0.16
362 0.19
363 0.21
364 0.21
365 0.21
366 0.21
367 0.21
368 0.18
369 0.19
370 0.17
371 0.15
372 0.2
373 0.24
374 0.33
375 0.42
376 0.51
377 0.59
378 0.69
379 0.79
380 0.83
381 0.87
382 0.88
383 0.87
384 0.88
385 0.9
386 0.89
387 0.9
388 0.88
389 0.84
390 0.83
391 0.79
392 0.73
393 0.68
394 0.58
395 0.48
396 0.47
397 0.45
398 0.43
399 0.46
400 0.42
401 0.41
402 0.46
403 0.51
404 0.45
405 0.41
406 0.36
407 0.31
408 0.31
409 0.35
410 0.34
411 0.36
412 0.4
413 0.39
414 0.36
415 0.34
416 0.35
417 0.27
418 0.22
419 0.13
420 0.09
421 0.11
422 0.11
423 0.11
424 0.09
425 0.09
426 0.09
427 0.1
428 0.12
429 0.13
430 0.17
431 0.23
432 0.24
433 0.24
434 0.26
435 0.28
436 0.34
437 0.4
438 0.37
439 0.39
440 0.46
441 0.47
442 0.52
443 0.55
444 0.54
445 0.54
446 0.59
447 0.58
448 0.52
449 0.5
450 0.44
451 0.43
452 0.37
453 0.29
454 0.29
455 0.31
456 0.32
457 0.36
458 0.37
459 0.35
460 0.35
461 0.42
462 0.4
463 0.38
464 0.42
465 0.42
466 0.42
467 0.42
468 0.39
469 0.31
470 0.3
471 0.24
472 0.18
473 0.16
474 0.15
475 0.16
476 0.21
477 0.22
478 0.2
479 0.2
480 0.2
481 0.19
482 0.23
483 0.25
484 0.29
485 0.36
486 0.42
487 0.49
488 0.55
489 0.56
490 0.59
491 0.66
492 0.66
493 0.65
494 0.68
495 0.68
496 0.65
497 0.67
498 0.6
499 0.54
500 0.5
501 0.42
502 0.35
503 0.3
504 0.34
505 0.32
506 0.36
507 0.35
508 0.31
509 0.33
510 0.37
511 0.34
512 0.29
513 0.27
514 0.24
515 0.22
516 0.24
517 0.21
518 0.18
519 0.19
520 0.16
521 0.17
522 0.22
523 0.25
524 0.29
525 0.34
526 0.38
527 0.47
528 0.55
529 0.64
530 0.66
531 0.7
532 0.68
533 0.65
534 0.62
535 0.54
536 0.5
537 0.46
538 0.41
539 0.37
540 0.33
541 0.33
542 0.31
543 0.3
544 0.27
545 0.19
546 0.17
547 0.16
548 0.14
549 0.13
550 0.13
551 0.14
552 0.15
553 0.16
554 0.15
555 0.1
556 0.12
557 0.12
558 0.12
559 0.11
560 0.14
561 0.15
562 0.15
563 0.16
564 0.17
565 0.17
566 0.16
567 0.16
568 0.12
569 0.11
570 0.16
571 0.23
572 0.21
573 0.23
574 0.25
575 0.25
576 0.28
577 0.3
578 0.26
579 0.18
580 0.19
581 0.21
582 0.19
583 0.2
584 0.18
585 0.18
586 0.18
587 0.18
588 0.16
589 0.12
590 0.12
591 0.14
592 0.14
593 0.11
594 0.15
595 0.15
596 0.17
597 0.17
598 0.17
599 0.15
600 0.15
601 0.22
602 0.25
603 0.24
604 0.29
605 0.3
606 0.3
607 0.3
608 0.29
609 0.27
610 0.27
611 0.28
612 0.28
613 0.29
614 0.29
615 0.32
616 0.31
617 0.28
618 0.22
619 0.22
620 0.18
621 0.17
622 0.17
623 0.14
624 0.14
625 0.14
626 0.15
627 0.14
628 0.13
629 0.11
630 0.11