Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5G824

Protein Details
Accession A0A5C5G824    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-33QIARIRRAPIHRRIKHCVYGHydrophilic
NLS Segment(s)
PositionSequence
264-275KKAKAVREKKGK
316-337GRRGRRGGAGRERSSRSRRERR
Subcellular Location(s) mito 9, plas 7, nucl 4, golg 2, cyto 1, extr 1, pero 1, E.R. 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAPDGPPPLTKAQIARIRRAPIHRRIKHCVYGALALAVIGAVANVTCLVLGAVWARHIVDAQRWFVLHYTVAAVLSIMWMSYSLVFERHIKFLNYPDQLQIDLVLRRLHFLLGLLSILQDAAVRRARHVHRRLLLGLHVQAELCQAQPTRRTLKPASERERRRLTDAGPALTLFAPVASQLGITTPVLGALQLLLGVTLYRNPIINPPLDQHGMPIPQDPETGLPMPLDAKGQPILPEWLLPRDPKTGELLPCDHSGNLLDPKKAKAVREKKGKGEEAAPWGTDTEGKEDDSSAGDDDSDEDKSLLENKGMQELGRRGRRGGAGRERSSRSRRERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.49
4 0.52
5 0.56
6 0.6
7 0.67
8 0.67
9 0.68
10 0.75
11 0.75
12 0.76
13 0.79
14 0.8
15 0.78
16 0.72
17 0.65
18 0.57
19 0.52
20 0.45
21 0.36
22 0.27
23 0.2
24 0.16
25 0.11
26 0.07
27 0.04
28 0.03
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.1
46 0.11
47 0.15
48 0.19
49 0.21
50 0.22
51 0.21
52 0.22
53 0.22
54 0.21
55 0.15
56 0.11
57 0.11
58 0.1
59 0.1
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.04
66 0.03
67 0.04
68 0.04
69 0.05
70 0.06
71 0.06
72 0.07
73 0.09
74 0.14
75 0.17
76 0.19
77 0.21
78 0.21
79 0.23
80 0.27
81 0.34
82 0.32
83 0.3
84 0.3
85 0.28
86 0.27
87 0.25
88 0.21
89 0.16
90 0.14
91 0.15
92 0.15
93 0.14
94 0.15
95 0.15
96 0.14
97 0.11
98 0.1
99 0.09
100 0.07
101 0.07
102 0.06
103 0.05
104 0.05
105 0.05
106 0.04
107 0.05
108 0.04
109 0.09
110 0.14
111 0.14
112 0.15
113 0.24
114 0.29
115 0.38
116 0.44
117 0.48
118 0.46
119 0.5
120 0.5
121 0.44
122 0.4
123 0.33
124 0.28
125 0.21
126 0.17
127 0.14
128 0.12
129 0.12
130 0.1
131 0.08
132 0.08
133 0.08
134 0.1
135 0.13
136 0.17
137 0.22
138 0.23
139 0.29
140 0.29
141 0.37
142 0.45
143 0.51
144 0.56
145 0.6
146 0.63
147 0.65
148 0.71
149 0.64
150 0.59
151 0.51
152 0.44
153 0.43
154 0.4
155 0.33
156 0.25
157 0.23
158 0.19
159 0.17
160 0.16
161 0.07
162 0.05
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.04
172 0.05
173 0.04
174 0.05
175 0.05
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.02
183 0.02
184 0.02
185 0.03
186 0.04
187 0.05
188 0.05
189 0.06
190 0.06
191 0.1
192 0.12
193 0.13
194 0.14
195 0.15
196 0.18
197 0.19
198 0.18
199 0.16
200 0.17
201 0.17
202 0.16
203 0.17
204 0.15
205 0.14
206 0.15
207 0.14
208 0.12
209 0.13
210 0.14
211 0.12
212 0.1
213 0.1
214 0.11
215 0.11
216 0.11
217 0.08
218 0.09
219 0.09
220 0.1
221 0.11
222 0.12
223 0.14
224 0.13
225 0.15
226 0.14
227 0.17
228 0.19
229 0.19
230 0.21
231 0.23
232 0.23
233 0.23
234 0.27
235 0.28
236 0.28
237 0.31
238 0.3
239 0.29
240 0.3
241 0.3
242 0.24
243 0.2
244 0.18
245 0.18
246 0.24
247 0.24
248 0.26
249 0.26
250 0.28
251 0.35
252 0.37
253 0.38
254 0.41
255 0.48
256 0.54
257 0.64
258 0.68
259 0.69
260 0.75
261 0.74
262 0.66
263 0.6
264 0.55
265 0.51
266 0.47
267 0.39
268 0.3
269 0.27
270 0.24
271 0.23
272 0.19
273 0.17
274 0.16
275 0.17
276 0.17
277 0.17
278 0.18
279 0.16
280 0.16
281 0.12
282 0.11
283 0.1
284 0.1
285 0.12
286 0.13
287 0.12
288 0.12
289 0.11
290 0.11
291 0.12
292 0.17
293 0.15
294 0.15
295 0.17
296 0.18
297 0.23
298 0.24
299 0.23
300 0.26
301 0.32
302 0.4
303 0.45
304 0.45
305 0.42
306 0.46
307 0.53
308 0.53
309 0.56
310 0.57
311 0.59
312 0.64
313 0.7
314 0.71
315 0.74
316 0.74
317 0.74