Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FLZ3

Protein Details
Accession A0A5C5FLZ3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-146GPCPRPRRPASRPRSARPRFGRRNGSRGNRRPRPAREQSASBasic
NLS Segment(s)
PositionSequence
101-141RPGRLGPCPRPRRPASRPRSARPRFGRRNGSRGNRRPRPAR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences GAAHDPLVRFSGPRLSGRRPPRAGSLCASGLLKAKRCRNTAPGHSRSLRLGRGAPVHVRLLKGAPQNELPPWCFLVSLLHTSPSACQYIQDAHQLASLSRRPGRLGPCPRPRRPASRPRSARPRFGRRNGSRGNRRPRPAREQSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.48
4 0.56
5 0.65
6 0.61
7 0.6
8 0.63
9 0.62
10 0.59
11 0.53
12 0.49
13 0.4
14 0.38
15 0.35
16 0.26
17 0.27
18 0.27
19 0.31
20 0.33
21 0.4
22 0.46
23 0.49
24 0.52
25 0.54
26 0.58
27 0.62
28 0.65
29 0.61
30 0.61
31 0.59
32 0.56
33 0.53
34 0.48
35 0.4
36 0.32
37 0.29
38 0.25
39 0.26
40 0.27
41 0.24
42 0.22
43 0.24
44 0.23
45 0.21
46 0.19
47 0.17
48 0.19
49 0.22
50 0.21
51 0.19
52 0.19
53 0.2
54 0.22
55 0.22
56 0.18
57 0.15
58 0.15
59 0.13
60 0.12
61 0.11
62 0.11
63 0.11
64 0.13
65 0.12
66 0.12
67 0.12
68 0.12
69 0.13
70 0.12
71 0.12
72 0.09
73 0.09
74 0.1
75 0.12
76 0.13
77 0.16
78 0.15
79 0.14
80 0.16
81 0.16
82 0.15
83 0.18
84 0.19
85 0.19
86 0.21
87 0.22
88 0.22
89 0.27
90 0.32
91 0.37
92 0.45
93 0.51
94 0.59
95 0.67
96 0.71
97 0.75
98 0.75
99 0.75
100 0.75
101 0.76
102 0.73
103 0.75
104 0.78
105 0.79
106 0.84
107 0.8
108 0.81
109 0.8
110 0.83
111 0.82
112 0.83
113 0.85
114 0.8
115 0.85
116 0.84
117 0.85
118 0.84
119 0.84
120 0.86
121 0.84
122 0.86
123 0.86
124 0.85
125 0.85
126 0.84