Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G2D3

Protein Details
Accession A0A5C5G2D3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
86-105VRSVKDRRNRAPPVRVRFNKHydrophilic
NLS Segment(s)
PositionSequence
4-12KRRSGGRNK
92-105RRNRAPPVRVRFNK
Subcellular Location(s) cyto_nucl 5.833, mito 16.5, mito_nucl 13.333, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTKKRRSGGRNKNGRGHVASIRCSNCSRMCPKDKAVRRFTVRNMVETAAIRDLSDASVYPEYALPKLYIKIHYCISCAVHAHVVRVRSVKDRRNRAPPVRVRFNKDGKKISPAATAAVAAARN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.68
3 0.61
4 0.58
5 0.51
6 0.48
7 0.46
8 0.44
9 0.42
10 0.39
11 0.39
12 0.36
13 0.38
14 0.41
15 0.43
16 0.49
17 0.51
18 0.56
19 0.61
20 0.67
21 0.69
22 0.69
23 0.69
24 0.67
25 0.67
26 0.64
27 0.64
28 0.56
29 0.49
30 0.44
31 0.36
32 0.32
33 0.27
34 0.25
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.08
53 0.1
54 0.12
55 0.15
56 0.16
57 0.19
58 0.21
59 0.21
60 0.21
61 0.21
62 0.21
63 0.18
64 0.17
65 0.15
66 0.17
67 0.17
68 0.19
69 0.19
70 0.19
71 0.19
72 0.21
73 0.21
74 0.25
75 0.32
76 0.38
77 0.45
78 0.54
79 0.59
80 0.67
81 0.75
82 0.75
83 0.78
84 0.79
85 0.8
86 0.81
87 0.79
88 0.78
89 0.77
90 0.79
91 0.78
92 0.77
93 0.75
94 0.67
95 0.69
96 0.64
97 0.58
98 0.54
99 0.45
100 0.39
101 0.32
102 0.29
103 0.22