Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FWE8

Protein Details
Accession A0A5C5FWE8    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-98VKFFERQKLLRKIKQAKKALHydrophilic
263-291VEAGAAPKKKENRKQRKERKRAEQAAAGAHydrophilic
NLS Segment(s)
PositionSequence
11-18GKGRGRGG
216-227AAKKAKPAAAAA
232-236AKAKK
268-284APKKKENRKQRKERKRA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAEQHSAPSRGKGRGRGGAGSVSKLKAQLRQTKRLLARDDLNPDVRTTSERRLALLEDELAKAEQSNVEKKMVQRYRGVKFFERQKLLRKIKQAKKALSEVPDSAEAQATLLDARVDLYYVLRYPKTDKYVALFPDGVYAPFVPPSALDKDASTPAELKRQTLRAAIRDRIESGAMPAEAELGELGIEGEDDVGAGPAKRERDDEALEEEAAGERAAKKAKPAAAAAVPVSAKAKKAPAAPVAPEAEDEEEDEAGEADDAPGVEAGAAPKKKENRKQRKERKRAEQAAAGATGGGGAGDGDAPAEGKKAALASQDAAMKDASWKSKTKGEQLAEQDDFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.55
4 0.52
5 0.51
6 0.47
7 0.43
8 0.4
9 0.33
10 0.31
11 0.33
12 0.33
13 0.32
14 0.4
15 0.45
16 0.5
17 0.58
18 0.61
19 0.66
20 0.71
21 0.71
22 0.67
23 0.63
24 0.6
25 0.57
26 0.58
27 0.54
28 0.52
29 0.45
30 0.41
31 0.36
32 0.31
33 0.29
34 0.27
35 0.3
36 0.32
37 0.32
38 0.32
39 0.33
40 0.34
41 0.31
42 0.29
43 0.24
44 0.18
45 0.18
46 0.18
47 0.16
48 0.14
49 0.12
50 0.11
51 0.12
52 0.15
53 0.2
54 0.21
55 0.24
56 0.26
57 0.29
58 0.39
59 0.41
60 0.41
61 0.44
62 0.49
63 0.54
64 0.58
65 0.6
66 0.55
67 0.56
68 0.62
69 0.63
70 0.62
71 0.58
72 0.62
73 0.67
74 0.71
75 0.7
76 0.7
77 0.72
78 0.74
79 0.8
80 0.79
81 0.74
82 0.7
83 0.7
84 0.64
85 0.57
86 0.52
87 0.43
88 0.37
89 0.33
90 0.27
91 0.22
92 0.18
93 0.14
94 0.1
95 0.1
96 0.07
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.08
108 0.1
109 0.1
110 0.11
111 0.15
112 0.21
113 0.25
114 0.25
115 0.25
116 0.26
117 0.31
118 0.31
119 0.3
120 0.25
121 0.2
122 0.21
123 0.2
124 0.17
125 0.12
126 0.12
127 0.09
128 0.09
129 0.09
130 0.06
131 0.06
132 0.09
133 0.11
134 0.12
135 0.12
136 0.12
137 0.13
138 0.16
139 0.16
140 0.13
141 0.13
142 0.13
143 0.19
144 0.19
145 0.19
146 0.21
147 0.22
148 0.23
149 0.26
150 0.27
151 0.27
152 0.31
153 0.33
154 0.31
155 0.29
156 0.29
157 0.25
158 0.23
159 0.16
160 0.12
161 0.1
162 0.08
163 0.07
164 0.06
165 0.06
166 0.05
167 0.05
168 0.04
169 0.03
170 0.03
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.03
182 0.03
183 0.04
184 0.06
185 0.08
186 0.09
187 0.1
188 0.13
189 0.17
190 0.19
191 0.2
192 0.21
193 0.21
194 0.2
195 0.18
196 0.16
197 0.12
198 0.1
199 0.08
200 0.06
201 0.05
202 0.08
203 0.1
204 0.11
205 0.13
206 0.17
207 0.2
208 0.22
209 0.22
210 0.23
211 0.22
212 0.23
213 0.21
214 0.18
215 0.15
216 0.13
217 0.15
218 0.12
219 0.12
220 0.13
221 0.15
222 0.16
223 0.2
224 0.24
225 0.27
226 0.29
227 0.3
228 0.32
229 0.31
230 0.28
231 0.25
232 0.21
233 0.17
234 0.14
235 0.13
236 0.1
237 0.09
238 0.09
239 0.08
240 0.07
241 0.06
242 0.05
243 0.05
244 0.04
245 0.04
246 0.04
247 0.05
248 0.04
249 0.04
250 0.04
251 0.05
252 0.06
253 0.13
254 0.14
255 0.15
256 0.21
257 0.3
258 0.4
259 0.49
260 0.59
261 0.64
262 0.74
263 0.84
264 0.9
265 0.93
266 0.95
267 0.95
268 0.95
269 0.95
270 0.93
271 0.87
272 0.82
273 0.74
274 0.66
275 0.56
276 0.44
277 0.33
278 0.23
279 0.17
280 0.1
281 0.06
282 0.03
283 0.02
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.04
291 0.06
292 0.06
293 0.06
294 0.07
295 0.08
296 0.09
297 0.12
298 0.14
299 0.14
300 0.18
301 0.22
302 0.21
303 0.21
304 0.19
305 0.17
306 0.2
307 0.24
308 0.26
309 0.27
310 0.31
311 0.34
312 0.42
313 0.47
314 0.51
315 0.55
316 0.53
317 0.58
318 0.6
319 0.65
320 0.59