Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FSQ4

Protein Details
Accession A0A5C5FSQ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
450-477RILTEETGKIPRRRRRRRSSAAPGTPGLHydrophilic
NLS Segment(s)
PositionSequence
458-469KIPRRRRRRRSS
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00153  Mito_carr  
Amino Acid Sequences MDAQPSAPRTHPLRPYSVSPSLDDWSSPAAASAAAASGGARGAGASTAVPPSLRMPPPTDRYGRADGLLGVPASSSSGEAGGAAAQAGTVLRAFVASSLLSFTGVALVQPFEVGKTLAQVQWVPRGEGAELGWDADEGIADEVVEIEDEGDAEAYFEDLRAASGPSFQPPGGGNSSLAPPRPTSPGGYLTRGGVVGADSALGTRPEWIMPIVVQGGVWDMIKAVGRWKGEGWASLWKGQLTTCVLDSLTTAIQPFFLSALTTMLLPSSSFSALPLIYAPKPGPLLVLTTLSHTLTTVLLSPLDLVRTRLIVQSAQPQHRKYKGPLHALRTIAEEEGGLWTTFFHPNLLFPALLEGIVRPLLHLSTPLIISRYLHLEPSASPLSFGLAELVLGTAGLLVTLPLETVRKRLQLQSRAAFVRAGRAGGVGRAWRTCVETRPQPYAGVVEAVYRILTEETGKIPRRRRRRRSSAAPGTPGLAGAPSPGLGVPTTPGADDDKEDLATAGLGASGGLRQLYRGFGMGVGANVVVFLLALIAGGEEASGWAEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.59
4 0.61
5 0.55
6 0.48
7 0.47
8 0.42
9 0.39
10 0.33
11 0.26
12 0.21
13 0.2
14 0.17
15 0.14
16 0.11
17 0.1
18 0.1
19 0.09
20 0.06
21 0.05
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.13
39 0.21
40 0.23
41 0.25
42 0.3
43 0.37
44 0.44
45 0.5
46 0.51
47 0.47
48 0.5
49 0.53
50 0.49
51 0.42
52 0.37
53 0.31
54 0.28
55 0.25
56 0.19
57 0.13
58 0.11
59 0.1
60 0.1
61 0.09
62 0.08
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.06
83 0.05
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.06
102 0.08
103 0.11
104 0.11
105 0.13
106 0.15
107 0.16
108 0.24
109 0.25
110 0.23
111 0.22
112 0.22
113 0.21
114 0.2
115 0.18
116 0.12
117 0.11
118 0.11
119 0.1
120 0.09
121 0.08
122 0.07
123 0.07
124 0.04
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.06
149 0.06
150 0.09
151 0.1
152 0.12
153 0.14
154 0.13
155 0.14
156 0.14
157 0.18
158 0.17
159 0.17
160 0.16
161 0.15
162 0.18
163 0.18
164 0.19
165 0.16
166 0.15
167 0.16
168 0.2
169 0.2
170 0.19
171 0.21
172 0.27
173 0.29
174 0.3
175 0.29
176 0.25
177 0.25
178 0.22
179 0.19
180 0.11
181 0.08
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.07
199 0.07
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.04
207 0.05
208 0.06
209 0.06
210 0.08
211 0.12
212 0.12
213 0.13
214 0.13
215 0.16
216 0.16
217 0.17
218 0.15
219 0.19
220 0.2
221 0.22
222 0.22
223 0.19
224 0.19
225 0.18
226 0.19
227 0.14
228 0.13
229 0.11
230 0.1
231 0.1
232 0.1
233 0.1
234 0.09
235 0.07
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.05
243 0.04
244 0.04
245 0.04
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.04
252 0.04
253 0.04
254 0.05
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.06
261 0.07
262 0.08
263 0.07
264 0.09
265 0.09
266 0.09
267 0.1
268 0.09
269 0.09
270 0.07
271 0.09
272 0.08
273 0.1
274 0.09
275 0.1
276 0.11
277 0.1
278 0.1
279 0.08
280 0.08
281 0.06
282 0.07
283 0.06
284 0.06
285 0.05
286 0.05
287 0.06
288 0.06
289 0.07
290 0.07
291 0.07
292 0.07
293 0.09
294 0.09
295 0.1
296 0.11
297 0.1
298 0.12
299 0.19
300 0.25
301 0.31
302 0.35
303 0.37
304 0.43
305 0.47
306 0.5
307 0.46
308 0.49
309 0.5
310 0.56
311 0.59
312 0.58
313 0.57
314 0.54
315 0.5
316 0.43
317 0.36
318 0.25
319 0.2
320 0.14
321 0.09
322 0.09
323 0.09
324 0.06
325 0.05
326 0.06
327 0.08
328 0.1
329 0.1
330 0.1
331 0.09
332 0.1
333 0.13
334 0.14
335 0.11
336 0.09
337 0.11
338 0.1
339 0.1
340 0.09
341 0.07
342 0.06
343 0.07
344 0.07
345 0.05
346 0.06
347 0.06
348 0.06
349 0.07
350 0.07
351 0.08
352 0.09
353 0.09
354 0.1
355 0.1
356 0.1
357 0.11
358 0.15
359 0.13
360 0.13
361 0.13
362 0.13
363 0.13
364 0.18
365 0.19
366 0.14
367 0.14
368 0.14
369 0.15
370 0.14
371 0.13
372 0.08
373 0.06
374 0.06
375 0.05
376 0.06
377 0.04
378 0.04
379 0.03
380 0.03
381 0.02
382 0.02
383 0.02
384 0.02
385 0.02
386 0.03
387 0.03
388 0.04
389 0.06
390 0.07
391 0.12
392 0.16
393 0.2
394 0.23
395 0.3
396 0.39
397 0.45
398 0.53
399 0.52
400 0.55
401 0.52
402 0.5
403 0.45
404 0.36
405 0.34
406 0.27
407 0.23
408 0.17
409 0.17
410 0.16
411 0.15
412 0.17
413 0.13
414 0.14
415 0.14
416 0.16
417 0.15
418 0.2
419 0.22
420 0.25
421 0.3
422 0.36
423 0.4
424 0.45
425 0.45
426 0.41
427 0.39
428 0.36
429 0.29
430 0.22
431 0.17
432 0.13
433 0.12
434 0.11
435 0.1
436 0.08
437 0.08
438 0.07
439 0.08
440 0.08
441 0.09
442 0.13
443 0.21
444 0.29
445 0.35
446 0.45
447 0.54
448 0.64
449 0.73
450 0.81
451 0.84
452 0.88
453 0.91
454 0.93
455 0.94
456 0.94
457 0.91
458 0.85
459 0.74
460 0.65
461 0.54
462 0.43
463 0.32
464 0.21
465 0.12
466 0.08
467 0.08
468 0.06
469 0.06
470 0.06
471 0.07
472 0.07
473 0.07
474 0.08
475 0.1
476 0.1
477 0.1
478 0.11
479 0.13
480 0.14
481 0.16
482 0.17
483 0.17
484 0.17
485 0.17
486 0.15
487 0.13
488 0.12
489 0.09
490 0.06
491 0.05
492 0.04
493 0.04
494 0.04
495 0.04
496 0.05
497 0.06
498 0.06
499 0.07
500 0.09
501 0.11
502 0.12
503 0.13
504 0.12
505 0.12
506 0.14
507 0.13
508 0.12
509 0.11
510 0.09
511 0.08
512 0.07
513 0.07
514 0.05
515 0.04
516 0.03
517 0.03
518 0.02
519 0.03
520 0.03
521 0.03
522 0.03
523 0.03
524 0.03
525 0.03
526 0.03