Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FS59

Protein Details
Accession A0A5C5FS59    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60TACPSRRRPCTSPRTLRPRFHydrophilic
NLS Segment(s)
PositionSequence
66-78PLRPRGRTRPSQR
92-143LRSRGAALRPLRRPSPRSSPPSPVRPTATTALPPRRAPRRFVSLLRPRPPRL
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MLLLPRCHRPWLRRLFRPSCTLSPAATSSPFRDPTSRPACTACPSRRRPCTSPRTLRPRFTAHPAPLRPRGRTRPSQRVHTASTRDRPGPCLRSRGAALRPLRRPSPRSSPPSPVRPTATTALPPRRAPRRFVSLLRPRPPRLAALARPVSAQAPARAAARPAAAAAAGATPWASSACTSASLAGANGPSGRPCECAGSTRRRGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.76
4 0.76
5 0.73
6 0.66
7 0.62
8 0.55
9 0.45
10 0.41
11 0.38
12 0.33
13 0.3
14 0.28
15 0.26
16 0.3
17 0.32
18 0.31
19 0.33
20 0.33
21 0.4
22 0.46
23 0.44
24 0.4
25 0.39
26 0.4
27 0.42
28 0.49
29 0.47
30 0.49
31 0.56
32 0.64
33 0.7
34 0.75
35 0.75
36 0.76
37 0.77
38 0.78
39 0.79
40 0.8
41 0.81
42 0.8
43 0.8
44 0.75
45 0.72
46 0.64
47 0.62
48 0.6
49 0.55
50 0.57
51 0.56
52 0.57
53 0.59
54 0.6
55 0.57
56 0.57
57 0.6
58 0.59
59 0.64
60 0.67
61 0.68
62 0.68
63 0.72
64 0.69
65 0.65
66 0.62
67 0.58
68 0.55
69 0.5
70 0.52
71 0.47
72 0.45
73 0.41
74 0.42
75 0.42
76 0.42
77 0.39
78 0.38
79 0.35
80 0.34
81 0.35
82 0.35
83 0.31
84 0.31
85 0.34
86 0.36
87 0.4
88 0.4
89 0.44
90 0.43
91 0.44
92 0.43
93 0.48
94 0.48
95 0.51
96 0.52
97 0.56
98 0.57
99 0.62
100 0.6
101 0.53
102 0.49
103 0.43
104 0.43
105 0.36
106 0.32
107 0.27
108 0.31
109 0.35
110 0.35
111 0.36
112 0.39
113 0.46
114 0.47
115 0.47
116 0.46
117 0.47
118 0.48
119 0.49
120 0.54
121 0.55
122 0.62
123 0.65
124 0.66
125 0.6
126 0.6
127 0.58
128 0.49
129 0.45
130 0.43
131 0.38
132 0.41
133 0.42
134 0.38
135 0.36
136 0.35
137 0.29
138 0.24
139 0.23
140 0.15
141 0.14
142 0.15
143 0.16
144 0.16
145 0.16
146 0.15
147 0.14
148 0.13
149 0.11
150 0.1
151 0.08
152 0.08
153 0.07
154 0.06
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.07
164 0.08
165 0.09
166 0.1
167 0.1
168 0.11
169 0.1
170 0.1
171 0.11
172 0.1
173 0.09
174 0.1
175 0.1
176 0.11
177 0.13
178 0.14
179 0.15
180 0.16
181 0.21
182 0.22
183 0.28
184 0.34
185 0.42