Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FNQ9

Protein Details
Accession A0A5C5FNQ9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-39CAAATRPRLARRPRLPPPRRRRAVARLPGHydrophilic
NLS Segment(s)
PositionSequence
16-74RPRLARRPRLPPPRRRRAVARLPGRLRRAARRHPTAHSTARTPTRPPGRRRTVGARARP
Subcellular Location(s) cyto_nucl 10.5, mito 7, nucl 18.5
Family & Domain DBs
Amino Acid Sequences MSRRCASTPTCAAATRPRLARRPRLPPPRRRRAVARLPGRLRRAARRHPTAHSTARTPTRPPGRRRTVGARARPQSPSTLARRPSEALRPTATSCPSRTASAYLSRPTRTTTLPITSSAPSLSPLRAHRPRRQACASSSAGTGSSARSSDLGASSGSACSATGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.45
4 0.48
5 0.54
6 0.61
7 0.69
8 0.69
9 0.73
10 0.77
11 0.81
12 0.84
13 0.86
14 0.89
15 0.89
16 0.87
17 0.83
18 0.81
19 0.8
20 0.81
21 0.8
22 0.78
23 0.76
24 0.77
25 0.79
26 0.74
27 0.7
28 0.64
29 0.64
30 0.64
31 0.64
32 0.66
33 0.68
34 0.68
35 0.66
36 0.67
37 0.64
38 0.61
39 0.54
40 0.47
41 0.44
42 0.46
43 0.44
44 0.4
45 0.41
46 0.45
47 0.5
48 0.55
49 0.59
50 0.62
51 0.63
52 0.66
53 0.66
54 0.66
55 0.66
56 0.67
57 0.66
58 0.6
59 0.59
60 0.57
61 0.49
62 0.41
63 0.36
64 0.33
65 0.3
66 0.33
67 0.34
68 0.32
69 0.33
70 0.33
71 0.31
72 0.33
73 0.3
74 0.27
75 0.25
76 0.26
77 0.26
78 0.27
79 0.27
80 0.22
81 0.21
82 0.23
83 0.23
84 0.22
85 0.21
86 0.2
87 0.2
88 0.24
89 0.26
90 0.26
91 0.28
92 0.28
93 0.28
94 0.28
95 0.28
96 0.23
97 0.24
98 0.23
99 0.24
100 0.25
101 0.25
102 0.25
103 0.24
104 0.23
105 0.2
106 0.16
107 0.14
108 0.14
109 0.14
110 0.16
111 0.19
112 0.28
113 0.37
114 0.44
115 0.5
116 0.6
117 0.65
118 0.69
119 0.73
120 0.68
121 0.63
122 0.62
123 0.57
124 0.48
125 0.42
126 0.34
127 0.27
128 0.23
129 0.2
130 0.15
131 0.13
132 0.12
133 0.12
134 0.12
135 0.12
136 0.13
137 0.13
138 0.13
139 0.11
140 0.12
141 0.12
142 0.11
143 0.11
144 0.09
145 0.08