Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FLE0

Protein Details
Accession A0A5C5FLE0   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-138EPAPKKKAPAKKAPAKKVVAHydrophilic
NLS Segment(s)
PositionSequence
43-56ATKKGKGKAKAKPR
74-104GRAPARGKGKAPAKKAPAKKAVASKGKAKSK
122-153PKKKAPAKKAPAKKVVAPAAKKPPARGATKKA
175-179RKRKR
Subcellular Location(s) cyto_nucl 14.5, nucl 25
Family & Domain DBs
Amino Acid Sequences MREAKEAAEAKYGGKGKGKAADTDEEDENDDDDASEASSSRAATKKGKGKAKAKPRDSMDEDSDDSMAGSSGSGRAPARGKGKAPAKKAPAKKAVASKGKAKSKALFNESDDSDESEDEPAPKKKAPAKKAPAKKVVAPAAKKPPARGATKKAAAASITLETDSDDSSVDEAPVRKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.39
5 0.4
6 0.37
7 0.38
8 0.4
9 0.38
10 0.4
11 0.37
12 0.3
13 0.3
14 0.27
15 0.23
16 0.18
17 0.14
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.11
28 0.14
29 0.17
30 0.22
31 0.3
32 0.37
33 0.44
34 0.52
35 0.57
36 0.63
37 0.68
38 0.74
39 0.77
40 0.73
41 0.73
42 0.69
43 0.69
44 0.66
45 0.62
46 0.54
47 0.48
48 0.44
49 0.37
50 0.32
51 0.23
52 0.17
53 0.12
54 0.09
55 0.05
56 0.04
57 0.03
58 0.04
59 0.04
60 0.06
61 0.06
62 0.09
63 0.11
64 0.16
65 0.2
66 0.21
67 0.22
68 0.27
69 0.36
70 0.39
71 0.43
72 0.45
73 0.47
74 0.52
75 0.57
76 0.57
77 0.56
78 0.52
79 0.51
80 0.52
81 0.53
82 0.53
83 0.5
84 0.5
85 0.5
86 0.54
87 0.54
88 0.49
89 0.46
90 0.46
91 0.5
92 0.46
93 0.4
94 0.37
95 0.38
96 0.36
97 0.33
98 0.26
99 0.22
100 0.18
101 0.16
102 0.14
103 0.11
104 0.11
105 0.1
106 0.14
107 0.16
108 0.18
109 0.19
110 0.24
111 0.31
112 0.39
113 0.46
114 0.52
115 0.59
116 0.67
117 0.76
118 0.79
119 0.8
120 0.75
121 0.71
122 0.68
123 0.67
124 0.64
125 0.58
126 0.56
127 0.58
128 0.62
129 0.59
130 0.53
131 0.54
132 0.52
133 0.57
134 0.57
135 0.54
136 0.57
137 0.6
138 0.61
139 0.53
140 0.48
141 0.4
142 0.34
143 0.29
144 0.21
145 0.17
146 0.15
147 0.14
148 0.12
149 0.13
150 0.12
151 0.1
152 0.08
153 0.08
154 0.09
155 0.1
156 0.09
157 0.12
158 0.15
159 0.24