Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FVX7

Protein Details
Accession A0A5C5FVX7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-90ESPSNKRVRLNSERHRRRFKVAHydrophilic
NLS Segment(s)
PositionSequence
73-88NKRVRLNSERHRRRFK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, mito 7.5, cyto_mito 6.999, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences SSSSSLRPATPEELWRHAPPVPYSLPVTTTSARSFAVRDGNVARAYRSLNRTLNENNVRRELKRQERFESPSNKRVRLNSERHRRRFKVAVGKAVSLALRTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.39
4 0.37
5 0.38
6 0.33
7 0.33
8 0.29
9 0.26
10 0.27
11 0.25
12 0.25
13 0.22
14 0.25
15 0.21
16 0.22
17 0.2
18 0.19
19 0.19
20 0.17
21 0.16
22 0.15
23 0.19
24 0.17
25 0.18
26 0.18
27 0.2
28 0.22
29 0.21
30 0.19
31 0.15
32 0.17
33 0.19
34 0.2
35 0.23
36 0.24
37 0.24
38 0.27
39 0.27
40 0.34
41 0.38
42 0.39
43 0.36
44 0.39
45 0.4
46 0.38
47 0.43
48 0.44
49 0.47
50 0.52
51 0.55
52 0.53
53 0.58
54 0.63
55 0.63
56 0.64
57 0.6
58 0.59
59 0.6
60 0.59
61 0.56
62 0.55
63 0.57
64 0.56
65 0.6
66 0.62
67 0.68
68 0.74
69 0.81
70 0.87
71 0.81
72 0.79
73 0.77
74 0.75
75 0.75
76 0.71
77 0.71
78 0.64
79 0.62
80 0.55
81 0.49
82 0.4