Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FSY2

Protein Details
Accession A0A5C5FSY2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
254-282ERARAARQAERERRRRERRRREEADPLKABasic
NLS Segment(s)
PositionSequence
246-275REAKVAERERARAARQAERERRRRERRRRE
452-462GGGRGAGKRRR
Subcellular Location(s) cyto 13, cyto_nucl 13.5, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR006565  BTP  
IPR009072  Histone-fold  
IPR019473  TFIID_su8_C  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF07524  Bromo_TP  
PF10406  TAF8_C  
Amino Acid Sequences MDSLAVSESYMSDSGRSSSSTSSSPSRALPLTAAAFDPVHHPAPPLPPSVPALVLHKLCAGALAHAGFDAASVEVLDEFEGIVAEFFGSLVEYAHALAELGRRHVPSAADVVAASAELGVGGPGDLLRELQRSEVSQDLPPTASLQITYARPRAPTPPGPRLTSDDEGDDGTLLPDAEDLASPPPTPPLSPLPPLLPEADADDDDEDAEFEEVLPLSGAGAGAGSAPPPSGSSAKSAAAAQRVAEREAKVAERERARAARQAERERRRRERRRREEADPLKASWLPELPPKHSWKHTPVYPQSAPPPPLPPPISRTQQAPSAAALAHLSTLRARLNDSQLVSSSLRNLIRRTRSAGAAGAGAGGGAGAGVVGLVGEGGDDGADVVDYEGEWYGAASAAGATNGLGGGANGKRRIRVLTVGAGGGSDDEEAEEKERAAKEAASGGGGIALGGGGGRGAGKRRRWLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.15
5 0.17
6 0.19
7 0.2
8 0.23
9 0.27
10 0.28
11 0.29
12 0.29
13 0.31
14 0.3
15 0.29
16 0.26
17 0.25
18 0.24
19 0.23
20 0.21
21 0.18
22 0.17
23 0.16
24 0.18
25 0.18
26 0.18
27 0.17
28 0.18
29 0.2
30 0.27
31 0.29
32 0.3
33 0.27
34 0.28
35 0.3
36 0.3
37 0.28
38 0.23
39 0.24
40 0.26
41 0.26
42 0.24
43 0.22
44 0.21
45 0.19
46 0.2
47 0.16
48 0.11
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.08
55 0.07
56 0.07
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.1
86 0.1
87 0.13
88 0.16
89 0.16
90 0.17
91 0.19
92 0.19
93 0.17
94 0.19
95 0.17
96 0.14
97 0.14
98 0.13
99 0.11
100 0.1
101 0.08
102 0.04
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.03
113 0.04
114 0.06
115 0.08
116 0.08
117 0.1
118 0.11
119 0.12
120 0.14
121 0.16
122 0.17
123 0.18
124 0.19
125 0.18
126 0.18
127 0.17
128 0.16
129 0.14
130 0.12
131 0.1
132 0.1
133 0.12
134 0.14
135 0.18
136 0.19
137 0.2
138 0.21
139 0.23
140 0.27
141 0.3
142 0.36
143 0.4
144 0.46
145 0.49
146 0.5
147 0.5
148 0.5
149 0.5
150 0.44
151 0.37
152 0.28
153 0.25
154 0.23
155 0.2
156 0.16
157 0.09
158 0.07
159 0.06
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.09
172 0.09
173 0.09
174 0.12
175 0.16
176 0.19
177 0.21
178 0.22
179 0.21
180 0.22
181 0.23
182 0.21
183 0.15
184 0.12
185 0.12
186 0.12
187 0.1
188 0.09
189 0.08
190 0.08
191 0.07
192 0.07
193 0.05
194 0.04
195 0.04
196 0.04
197 0.03
198 0.04
199 0.04
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.05
217 0.07
218 0.07
219 0.1
220 0.12
221 0.12
222 0.13
223 0.13
224 0.13
225 0.14
226 0.13
227 0.12
228 0.14
229 0.14
230 0.15
231 0.17
232 0.15
233 0.14
234 0.16
235 0.16
236 0.15
237 0.17
238 0.2
239 0.2
240 0.22
241 0.25
242 0.27
243 0.27
244 0.3
245 0.31
246 0.33
247 0.38
248 0.46
249 0.52
250 0.59
251 0.67
252 0.71
253 0.78
254 0.82
255 0.86
256 0.87
257 0.89
258 0.9
259 0.92
260 0.89
261 0.84
262 0.84
263 0.81
264 0.78
265 0.69
266 0.59
267 0.5
268 0.45
269 0.39
270 0.29
271 0.23
272 0.15
273 0.18
274 0.21
275 0.22
276 0.27
277 0.31
278 0.34
279 0.38
280 0.42
281 0.43
282 0.47
283 0.47
284 0.51
285 0.52
286 0.55
287 0.52
288 0.5
289 0.49
290 0.48
291 0.46
292 0.38
293 0.37
294 0.31
295 0.36
296 0.36
297 0.33
298 0.32
299 0.36
300 0.39
301 0.37
302 0.37
303 0.33
304 0.35
305 0.35
306 0.3
307 0.24
308 0.21
309 0.2
310 0.17
311 0.15
312 0.09
313 0.08
314 0.07
315 0.08
316 0.06
317 0.09
318 0.1
319 0.11
320 0.13
321 0.16
322 0.21
323 0.25
324 0.25
325 0.24
326 0.23
327 0.27
328 0.25
329 0.22
330 0.19
331 0.2
332 0.23
333 0.24
334 0.27
335 0.31
336 0.37
337 0.39
338 0.43
339 0.41
340 0.4
341 0.39
342 0.37
343 0.29
344 0.23
345 0.2
346 0.14
347 0.1
348 0.08
349 0.06
350 0.04
351 0.03
352 0.02
353 0.02
354 0.01
355 0.01
356 0.01
357 0.01
358 0.01
359 0.01
360 0.01
361 0.01
362 0.02
363 0.02
364 0.02
365 0.02
366 0.02
367 0.02
368 0.02
369 0.03
370 0.03
371 0.03
372 0.03
373 0.03
374 0.04
375 0.04
376 0.05
377 0.05
378 0.04
379 0.05
380 0.05
381 0.05
382 0.04
383 0.04
384 0.05
385 0.05
386 0.05
387 0.04
388 0.04
389 0.04
390 0.04
391 0.04
392 0.03
393 0.08
394 0.11
395 0.16
396 0.22
397 0.23
398 0.26
399 0.28
400 0.32
401 0.31
402 0.34
403 0.34
404 0.34
405 0.35
406 0.33
407 0.31
408 0.27
409 0.23
410 0.17
411 0.13
412 0.07
413 0.05
414 0.05
415 0.07
416 0.08
417 0.1
418 0.11
419 0.11
420 0.16
421 0.17
422 0.19
423 0.2
424 0.19
425 0.19
426 0.22
427 0.22
428 0.17
429 0.16
430 0.14
431 0.13
432 0.12
433 0.1
434 0.05
435 0.04
436 0.03
437 0.03
438 0.03
439 0.02
440 0.03
441 0.04
442 0.07
443 0.14
444 0.22
445 0.29