Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FPI0

Protein Details
Accession A0A5C5FPI0   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
191-219VVLCRECARKLRHGRRKAKEDRDKRAEVDBasic
NLS Segment(s)
PositionSequence
199-214RKLRHGRRKAKEDRDK
Subcellular Location(s) cyto 4.5, cyto_nucl 10, mito 8, nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019129  Folate-sensitive_fs_Fra10Ac1  
Pfam View protein in Pfam  
PF09725  Fra10Ac1  
Amino Acid Sequences MSSSRYRAPGDPGPSTSKRPRVVDTLAPETAHERHQRLHALRRAYDRGKPPPRPASRHELDVLKERHQFVRDSDVDPSTLSWEDQLAHRHYETLFREYAVVNLKHYKSGAIALRWRTESEVLSGTGHLTCGSLRCAFHAPSPAVLASLSLSDDVPPDPADERPLVEARLEELEVPFRYVEAGEAKSVLVKVVLCRECARKLRHGRRKAKEDRDKRAEVDPGACVRLLVLTDVGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.55
4 0.57
5 0.57
6 0.57
7 0.58
8 0.56
9 0.58
10 0.57
11 0.55
12 0.53
13 0.47
14 0.43
15 0.39
16 0.36
17 0.33
18 0.32
19 0.31
20 0.28
21 0.29
22 0.34
23 0.42
24 0.45
25 0.52
26 0.51
27 0.52
28 0.54
29 0.58
30 0.61
31 0.56
32 0.57
33 0.55
34 0.6
35 0.64
36 0.66
37 0.68
38 0.71
39 0.75
40 0.74
41 0.71
42 0.7
43 0.63
44 0.6
45 0.55
46 0.48
47 0.42
48 0.45
49 0.43
50 0.38
51 0.4
52 0.38
53 0.38
54 0.36
55 0.35
56 0.28
57 0.34
58 0.31
59 0.29
60 0.29
61 0.26
62 0.24
63 0.23
64 0.21
65 0.14
66 0.13
67 0.11
68 0.09
69 0.08
70 0.09
71 0.11
72 0.16
73 0.15
74 0.17
75 0.17
76 0.18
77 0.17
78 0.23
79 0.23
80 0.22
81 0.2
82 0.18
83 0.19
84 0.18
85 0.21
86 0.2
87 0.18
88 0.16
89 0.21
90 0.21
91 0.21
92 0.21
93 0.19
94 0.13
95 0.17
96 0.18
97 0.16
98 0.2
99 0.21
100 0.23
101 0.23
102 0.23
103 0.2
104 0.18
105 0.16
106 0.13
107 0.13
108 0.11
109 0.11
110 0.1
111 0.1
112 0.08
113 0.08
114 0.06
115 0.05
116 0.05
117 0.06
118 0.08
119 0.09
120 0.09
121 0.11
122 0.14
123 0.14
124 0.16
125 0.2
126 0.18
127 0.17
128 0.18
129 0.16
130 0.13
131 0.12
132 0.11
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.07
142 0.07
143 0.07
144 0.08
145 0.09
146 0.11
147 0.11
148 0.12
149 0.13
150 0.14
151 0.14
152 0.13
153 0.13
154 0.12
155 0.13
156 0.12
157 0.1
158 0.09
159 0.13
160 0.13
161 0.14
162 0.12
163 0.11
164 0.11
165 0.1
166 0.12
167 0.11
168 0.12
169 0.11
170 0.12
171 0.12
172 0.13
173 0.13
174 0.11
175 0.08
176 0.08
177 0.1
178 0.19
179 0.2
180 0.21
181 0.25
182 0.3
183 0.36
184 0.43
185 0.46
186 0.48
187 0.58
188 0.67
189 0.74
190 0.8
191 0.83
192 0.86
193 0.91
194 0.92
195 0.92
196 0.91
197 0.91
198 0.91
199 0.89
200 0.83
201 0.75
202 0.71
203 0.65
204 0.57
205 0.5
206 0.44
207 0.38
208 0.35
209 0.32
210 0.25
211 0.19
212 0.18
213 0.15
214 0.12
215 0.09