Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G586

Protein Details
Accession A0A5C5G586   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-136SSGGGRPRRLERRRRRLCRERSLTACBasic
NLS Segment(s)
PositionSequence
115-126GRPRRLERRRRR
Subcellular Location(s) cyto 8, extr 3, mito 3, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006414  P:translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05831  Ribosomal_P1  
Amino Acid Sequences MATSELASTYAALILADEGLEITADKIVAIASAANVEVEPIWASLLAKALEGKDVKELLTNVGAGGAAPAAGAAPGAAAGGAAEEAKEEAKEEDKEESDDDMGCVLAFFSSSGGGRPRRLERRRRRLCRERSLTACPHLVPPVCSQHSFLDSPRHHALSVPAAPSSHRPVPRRDSLRPTCPRPPTSRSLASPLPPRIHPRSRAPPSSTQLRTLRRASDSPLWEDFLRPPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.05
28 0.06
29 0.06
30 0.07
31 0.07
32 0.1
33 0.09
34 0.09
35 0.1
36 0.1
37 0.15
38 0.15
39 0.15
40 0.16
41 0.16
42 0.16
43 0.17
44 0.18
45 0.14
46 0.15
47 0.14
48 0.11
49 0.1
50 0.1
51 0.07
52 0.06
53 0.04
54 0.03
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.08
78 0.1
79 0.11
80 0.13
81 0.13
82 0.15
83 0.15
84 0.15
85 0.12
86 0.11
87 0.1
88 0.08
89 0.07
90 0.06
91 0.05
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.05
100 0.09
101 0.11
102 0.13
103 0.16
104 0.23
105 0.33
106 0.41
107 0.51
108 0.58
109 0.68
110 0.78
111 0.84
112 0.87
113 0.88
114 0.89
115 0.89
116 0.85
117 0.8
118 0.74
119 0.71
120 0.63
121 0.56
122 0.47
123 0.37
124 0.31
125 0.28
126 0.23
127 0.19
128 0.19
129 0.24
130 0.24
131 0.24
132 0.25
133 0.24
134 0.27
135 0.26
136 0.24
137 0.27
138 0.26
139 0.32
140 0.33
141 0.32
142 0.28
143 0.28
144 0.28
145 0.25
146 0.27
147 0.22
148 0.19
149 0.18
150 0.19
151 0.22
152 0.26
153 0.26
154 0.3
155 0.32
156 0.39
157 0.46
158 0.55
159 0.59
160 0.59
161 0.62
162 0.64
163 0.71
164 0.72
165 0.72
166 0.71
167 0.72
168 0.71
169 0.68
170 0.66
171 0.62
172 0.62
173 0.61
174 0.55
175 0.54
176 0.52
177 0.51
178 0.53
179 0.53
180 0.49
181 0.46
182 0.5
183 0.53
184 0.57
185 0.58
186 0.59
187 0.64
188 0.69
189 0.73
190 0.71
191 0.72
192 0.7
193 0.73
194 0.66
195 0.63
196 0.63
197 0.62
198 0.62
199 0.58
200 0.58
201 0.53
202 0.53
203 0.52
204 0.52
205 0.49
206 0.48
207 0.46
208 0.44
209 0.39
210 0.39