Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TN48

Protein Details
Accession G4TN48   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNQAMRRPRKSPKDIRRSKSKSPYLENHydrophilic
NLS Segment(s)
PositionSequence
6-22RRPRKSPKDIRRSKSKS
42-55KPKKPNSAKRKVAR
122-122K
Subcellular Location(s) nucl 15.5, mito_nucl 11, cyto 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MNQAMRRPRKSPKDIRRSKSKSPYLENGPQKKGVCISLMIAKPKKPNSAKRKVARVKLSTGKTILCYIPGEGHNLQEHSVVLVRGGRAQDLPGVRYRLVRGAYDFNGVVNRANARSKYGSKKPKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.87
5 0.87
6 0.86
7 0.84
8 0.8
9 0.77
10 0.77
11 0.74
12 0.75
13 0.75
14 0.72
15 0.66
16 0.64
17 0.58
18 0.51
19 0.45
20 0.37
21 0.28
22 0.21
23 0.2
24 0.21
25 0.23
26 0.28
27 0.28
28 0.3
29 0.35
30 0.38
31 0.46
32 0.46
33 0.54
34 0.58
35 0.66
36 0.72
37 0.73
38 0.8
39 0.78
40 0.78
41 0.76
42 0.69
43 0.64
44 0.62
45 0.58
46 0.49
47 0.43
48 0.35
49 0.28
50 0.27
51 0.2
52 0.14
53 0.12
54 0.1
55 0.12
56 0.12
57 0.15
58 0.13
59 0.15
60 0.15
61 0.15
62 0.15
63 0.13
64 0.12
65 0.09
66 0.1
67 0.08
68 0.07
69 0.08
70 0.08
71 0.1
72 0.1
73 0.1
74 0.09
75 0.1
76 0.13
77 0.13
78 0.15
79 0.17
80 0.2
81 0.2
82 0.22
83 0.23
84 0.24
85 0.25
86 0.24
87 0.23
88 0.26
89 0.27
90 0.28
91 0.26
92 0.22
93 0.22
94 0.21
95 0.19
96 0.16
97 0.17
98 0.18
99 0.23
100 0.23
101 0.27
102 0.33
103 0.39
104 0.46
105 0.54
106 0.62