Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FSP4

Protein Details
Accession A0A5C5FSP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
255-275LPSWSEVRRARKERNLAKARAHydrophilic
NLS Segment(s)
PositionSequence
262-273RRARKERNLAKA
Subcellular Location(s) plas 11, mito 6, extr 6, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASISIRHEQLSALSRTKRLFWLSSCVGILSLVGVCVAVLPWGIARTQGEWAAFAVVAASSFVWVTLPIAASGSMQLRRRMLSAWWAMMVAAVAHLALAIYLEFSFVEQQASWVDFCHAADPTWTVDACRKRAGQLSLAFPLTAAILEVGAIPLLWLLRRSFAKLPQDHIYNTLMDDDLPPGWHNPPAELAVDSSASDSDDDLGPPRSAGLASPRRNSRTRVGSGTDKDKDTGSDWYELGSRKGHRSSRSVASGLPSWSEVRRARKERNLAKARASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.38
4 0.41
5 0.42
6 0.4
7 0.4
8 0.36
9 0.41
10 0.4
11 0.41
12 0.38
13 0.32
14 0.27
15 0.22
16 0.19
17 0.12
18 0.09
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.07
32 0.08
33 0.1
34 0.12
35 0.14
36 0.14
37 0.14
38 0.14
39 0.13
40 0.12
41 0.1
42 0.08
43 0.06
44 0.06
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.11
61 0.15
62 0.17
63 0.21
64 0.22
65 0.22
66 0.23
67 0.23
68 0.21
69 0.24
70 0.23
71 0.21
72 0.2
73 0.19
74 0.18
75 0.16
76 0.15
77 0.07
78 0.04
79 0.03
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.05
93 0.05
94 0.06
95 0.05
96 0.06
97 0.07
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.08
108 0.08
109 0.08
110 0.09
111 0.09
112 0.08
113 0.13
114 0.17
115 0.19
116 0.21
117 0.21
118 0.22
119 0.27
120 0.28
121 0.28
122 0.27
123 0.27
124 0.26
125 0.25
126 0.23
127 0.18
128 0.16
129 0.11
130 0.08
131 0.05
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.02
138 0.02
139 0.02
140 0.02
141 0.03
142 0.03
143 0.04
144 0.04
145 0.08
146 0.09
147 0.13
148 0.15
149 0.21
150 0.3
151 0.3
152 0.35
153 0.35
154 0.37
155 0.34
156 0.34
157 0.3
158 0.21
159 0.2
160 0.16
161 0.12
162 0.1
163 0.1
164 0.08
165 0.07
166 0.07
167 0.08
168 0.09
169 0.1
170 0.12
171 0.12
172 0.11
173 0.13
174 0.13
175 0.14
176 0.13
177 0.12
178 0.1
179 0.1
180 0.1
181 0.09
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.07
188 0.07
189 0.09
190 0.11
191 0.11
192 0.1
193 0.1
194 0.09
195 0.09
196 0.1
197 0.17
198 0.25
199 0.3
200 0.37
201 0.43
202 0.48
203 0.52
204 0.55
205 0.54
206 0.53
207 0.53
208 0.51
209 0.5
210 0.53
211 0.55
212 0.59
213 0.54
214 0.47
215 0.43
216 0.39
217 0.35
218 0.29
219 0.3
220 0.24
221 0.23
222 0.21
223 0.21
224 0.24
225 0.24
226 0.24
227 0.24
228 0.25
229 0.29
230 0.37
231 0.42
232 0.44
233 0.49
234 0.52
235 0.55
236 0.57
237 0.51
238 0.45
239 0.43
240 0.41
241 0.36
242 0.31
243 0.25
244 0.22
245 0.22
246 0.29
247 0.32
248 0.38
249 0.47
250 0.54
251 0.62
252 0.69
253 0.79
254 0.8
255 0.84
256 0.84
257 0.78