Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FSP4

Protein Details
Accession A0A5C5FSP4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
255-275LPSWSEVRRARKERNLAKARAHydrophilic
NLS Segment(s)
PositionSequence
262-273RRARKERNLAKA
Subcellular Location(s) E.R. 2, extr 6, mito 6, plas 11
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASISIRHEQLSALSRTKRLFWLSSCVGILSLVGVCVAVLPWGIARTQGEWAAFAVVAASSFVWVTLPIAASGSMQLRRRMLSAWWAMMVAAVAHLALAIYLEFSFVEQQASWVDFCHAADPTWTVDACRKRAGQLSLAFPLTAAILEVGAIPLLWLLRRSFAKLPQDHIYNTLMDDDLPPGWHNPPAELAVDSSASDSDDDLGPPRSAGLASPRRNSRTRVGSGTDKDKDTGSDWYELGSRKGHRSSRSVASGLPSWSEVRRARKERNLAKARASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.38
4 0.41
5 0.42
6 0.4
7 0.4
8 0.36
9 0.41
10 0.4
11 0.41
12 0.38
13 0.32
14 0.27
15 0.22
16 0.19
17 0.12
18 0.09
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.07
32 0.08
33 0.1
34 0.12
35 0.14
36 0.14
37 0.14
38 0.14
39 0.13
40 0.12
41 0.1
42 0.08
43 0.06
44 0.06
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.11
61 0.15
62 0.17
63 0.21
64 0.22
65 0.22
66 0.23
67 0.23
68 0.21
69 0.24
70 0.23
71 0.21
72 0.2
73 0.19
74 0.18
75 0.16
76 0.15
77 0.07
78 0.04
79 0.03
80 0.03
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.05
93 0.05
94 0.06
95 0.05
96 0.06
97 0.07
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.08
108 0.08
109 0.08
110 0.09
111 0.09
112 0.08
113 0.13
114 0.17
115 0.19
116 0.21
117 0.21
118 0.22
119 0.27
120 0.28
121 0.28
122 0.27
123 0.27
124 0.26
125 0.25
126 0.23
127 0.18
128 0.16
129 0.11
130 0.08
131 0.05
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.02
138 0.02
139 0.02
140 0.02
141 0.03
142 0.03
143 0.04
144 0.04
145 0.08
146 0.09
147 0.13
148 0.15
149 0.21
150 0.3
151 0.3
152 0.35
153 0.35
154 0.37
155 0.34
156 0.34
157 0.3
158 0.21
159 0.2
160 0.16
161 0.12
162 0.1
163 0.1
164 0.08
165 0.07
166 0.07
167 0.08
168 0.09
169 0.1
170 0.12
171 0.12
172 0.11
173 0.13
174 0.13
175 0.14
176 0.13
177 0.12
178 0.1
179 0.1
180 0.1
181 0.09
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.07
188 0.07
189 0.09
190 0.11
191 0.11
192 0.1
193 0.1
194 0.09
195 0.09
196 0.1
197 0.17
198 0.25
199 0.3
200 0.37
201 0.43
202 0.48
203 0.52
204 0.55
205 0.54
206 0.53
207 0.53
208 0.51
209 0.5
210 0.53
211 0.55
212 0.59
213 0.54
214 0.47
215 0.43
216 0.39
217 0.35
218 0.29
219 0.3
220 0.24
221 0.23
222 0.21
223 0.21
224 0.24
225 0.24
226 0.24
227 0.24
228 0.25
229 0.29
230 0.37
231 0.42
232 0.44
233 0.49
234 0.52
235 0.55
236 0.57
237 0.51
238 0.45
239 0.43
240 0.41
241 0.36
242 0.31
243 0.25
244 0.22
245 0.22
246 0.29
247 0.32
248 0.38
249 0.47
250 0.54
251 0.62
252 0.69
253 0.79
254 0.8
255 0.84
256 0.84
257 0.78