Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FPK4

Protein Details
Accession A0A5C5FPK4   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKSSKKPQARIKQVLDKSFRHydrophilic
137-159EELPDLRPKGRKKQRVDSPEEDEAcidic
NLS Segment(s)
PositionSequence
5-9KSSKK
Subcellular Location(s) mito 12, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSKKPQARIKQVLDKSFRCVFCAHQGSVTCKLDNKTKIGRLDCKDCGQSFQTDITHLSEPVDLYSQWIDACEEANPVGQPAPRAKSATAQPSAQKKKRRADEDEDEGSEEDRDFEEGVDPAAGGDEGEEDEEELPDLRPKGRKKQRVDSPEEDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.84
4 0.82
5 0.78
6 0.69
7 0.65
8 0.63
9 0.54
10 0.46
11 0.41
12 0.35
13 0.38
14 0.41
15 0.35
16 0.33
17 0.35
18 0.38
19 0.44
20 0.43
21 0.34
22 0.32
23 0.34
24 0.37
25 0.38
26 0.39
27 0.38
28 0.41
29 0.47
30 0.5
31 0.56
32 0.53
33 0.56
34 0.54
35 0.5
36 0.49
37 0.42
38 0.4
39 0.33
40 0.3
41 0.24
42 0.23
43 0.2
44 0.17
45 0.18
46 0.17
47 0.16
48 0.15
49 0.14
50 0.12
51 0.11
52 0.11
53 0.11
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.08
72 0.1
73 0.13
74 0.14
75 0.15
76 0.15
77 0.18
78 0.22
79 0.27
80 0.26
81 0.26
82 0.29
83 0.38
84 0.47
85 0.5
86 0.54
87 0.56
88 0.63
89 0.7
90 0.72
91 0.69
92 0.68
93 0.69
94 0.68
95 0.63
96 0.55
97 0.47
98 0.4
99 0.34
100 0.25
101 0.17
102 0.11
103 0.08
104 0.08
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.07
126 0.08
127 0.11
128 0.13
129 0.17
130 0.24
131 0.31
132 0.42
133 0.52
134 0.61
135 0.66
136 0.75
137 0.82
138 0.84
139 0.86
140 0.83
141 0.8