Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G2U1

Protein Details
Accession A0A5C5G2U1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58ETFNNKTRRRWLPNVHHKRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MRPSLSLLKNTSRSALNYKRSQGGLYDGRSIQSGNNVGETFNNKTRRRWLPNVHHKRVWSEALGRSLALKVTAGALRTMDKVGGLDNYLFRMRPERLGDKGMELRQMVSAIPLAPALSLCAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.48
4 0.49
5 0.52
6 0.53
7 0.52
8 0.49
9 0.4
10 0.39
11 0.36
12 0.32
13 0.32
14 0.28
15 0.27
16 0.27
17 0.26
18 0.19
19 0.18
20 0.18
21 0.14
22 0.16
23 0.16
24 0.16
25 0.17
26 0.2
27 0.2
28 0.24
29 0.33
30 0.32
31 0.35
32 0.44
33 0.51
34 0.56
35 0.6
36 0.63
37 0.65
38 0.75
39 0.82
40 0.79
41 0.73
42 0.66
43 0.6
44 0.53
45 0.44
46 0.34
47 0.27
48 0.24
49 0.24
50 0.23
51 0.2
52 0.17
53 0.15
54 0.13
55 0.09
56 0.07
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.08
67 0.07
68 0.07
69 0.08
70 0.08
71 0.07
72 0.08
73 0.08
74 0.11
75 0.11
76 0.11
77 0.11
78 0.16
79 0.17
80 0.22
81 0.28
82 0.3
83 0.32
84 0.36
85 0.36
86 0.36
87 0.41
88 0.37
89 0.34
90 0.29
91 0.27
92 0.25
93 0.24
94 0.19
95 0.14
96 0.13
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.08