Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FQ15

Protein Details
Accession A0A5C5FQ15    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24VTLRTRKSYSTKSNGKRIVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MVQRVTLRTRKSYSTKSNGKRIVKTPGGKLRYLTVKKAASAPKCGDCHIALPGVPALRPRQYAQISKRQKTVQRAYGGSRCATCVRDRIVRAFLVEEAKIVKRVIAQQTKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.73
4 0.79
5 0.8
6 0.79
7 0.76
8 0.7
9 0.7
10 0.67
11 0.64
12 0.63
13 0.63
14 0.59
15 0.54
16 0.5
17 0.47
18 0.48
19 0.47
20 0.41
21 0.39
22 0.37
23 0.37
24 0.42
25 0.44
26 0.36
27 0.39
28 0.39
29 0.38
30 0.38
31 0.37
32 0.33
33 0.27
34 0.26
35 0.21
36 0.18
37 0.12
38 0.11
39 0.11
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.2
48 0.23
49 0.3
50 0.33
51 0.42
52 0.49
53 0.5
54 0.54
55 0.52
56 0.55
57 0.57
58 0.6
59 0.57
60 0.53
61 0.53
62 0.53
63 0.52
64 0.48
65 0.4
66 0.33
67 0.28
68 0.25
69 0.25
70 0.22
71 0.22
72 0.25
73 0.3
74 0.32
75 0.33
76 0.34
77 0.33
78 0.32
79 0.28
80 0.26
81 0.22
82 0.2
83 0.17
84 0.17
85 0.18
86 0.19
87 0.18
88 0.16
89 0.17
90 0.24
91 0.34
92 0.39
93 0.4
94 0.46