Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FWW9

Protein Details
Accession A0A5C5FWW9   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-128GLAEKKERTGRKLRKERKNRAKKFRGVAKVTKSBasic
NLS Segment(s)
PositionSequence
89-133RHRLIKFGLAEKKERTGRKLRKERKNRAKKFRGVAKVTKSAGGKK
Subcellular Location(s) cyto 4, mito 20, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPNGAVTIRTRKFLTNRLLQRKQMVVDVLHPTRANVSKDELRDKLAAMYKAPKDQVIVFGFRTQFGGGKSTGFALIYDSKEALKFEPRHRLIKFGLAEKKERTGRKLRKERKNRAKKFRGVAKVTKSAGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.5
4 0.59
5 0.66
6 0.71
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.31
15 0.34
16 0.3
17 0.29
18 0.27
19 0.24
20 0.26
21 0.3
22 0.27
23 0.22
24 0.26
25 0.28
26 0.32
27 0.37
28 0.33
29 0.31
30 0.3
31 0.29
32 0.27
33 0.27
34 0.24
35 0.2
36 0.26
37 0.25
38 0.27
39 0.27
40 0.23
41 0.2
42 0.19
43 0.24
44 0.19
45 0.19
46 0.17
47 0.19
48 0.19
49 0.17
50 0.18
51 0.12
52 0.12
53 0.1
54 0.12
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.11
71 0.17
72 0.21
73 0.26
74 0.36
75 0.39
76 0.46
77 0.46
78 0.49
79 0.42
80 0.45
81 0.43
82 0.4
83 0.44
84 0.39
85 0.43
86 0.41
87 0.47
88 0.46
89 0.47
90 0.46
91 0.5
92 0.57
93 0.64
94 0.73
95 0.76
96 0.8
97 0.88
98 0.93
99 0.93
100 0.95
101 0.94
102 0.94
103 0.94
104 0.92
105 0.9
106 0.89
107 0.88
108 0.84
109 0.82
110 0.78
111 0.77
112 0.69
113 0.65