Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FT27

Protein Details
Accession A0A5C5FT27    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPRNDSTKQKKSKAQPTKKTATKKGKSHydrophilic
NLS Segment(s)
PositionSequence
9-26QKKSKAQPTKKTATKKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPRNDSTKQKKSKAQPTKKTATKKGKSSSYNAYVNTKLAELKKADPTLKHTEAYQRAFDEWKAQQKSKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.87
5 0.86
6 0.84
7 0.84
8 0.83
9 0.8
10 0.78
11 0.77
12 0.75
13 0.71
14 0.66
15 0.63
16 0.59
17 0.54
18 0.47
19 0.43
20 0.35
21 0.32
22 0.28
23 0.21
24 0.17
25 0.14
26 0.16
27 0.15
28 0.17
29 0.22
30 0.25
31 0.27
32 0.25
33 0.31
34 0.37
35 0.37
36 0.35
37 0.31
38 0.36
39 0.41
40 0.43
41 0.4
42 0.33
43 0.32
44 0.33
45 0.33
46 0.31
47 0.3
48 0.37
49 0.4
50 0.41
51 0.45