Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FS65

Protein Details
Accession A0A5C5FS65   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
79-98VSPCTKKLAQSKQRHFNKCVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4.5, cyto_mito 8.666, cyto_nucl 7.333, mito 11.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MAAPTFEFTTASPAQAAPSPVESIAPMHVAPQDQAQLPQGTGPIEQGHSTMQLGAKGFLMKKMAASGQSAFQSPTDHMVSPCTKKLAQSKQRHFNKCVVVLPPLTLVSDSGSFGGPQLSLRVPRGDFSRAFGTRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.14
5 0.15
6 0.16
7 0.15
8 0.15
9 0.14
10 0.12
11 0.12
12 0.12
13 0.1
14 0.1
15 0.11
16 0.11
17 0.11
18 0.12
19 0.14
20 0.13
21 0.14
22 0.15
23 0.15
24 0.14
25 0.14
26 0.13
27 0.11
28 0.11
29 0.11
30 0.09
31 0.09
32 0.09
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.11
60 0.1
61 0.12
62 0.12
63 0.12
64 0.12
65 0.15
66 0.19
67 0.2
68 0.22
69 0.21
70 0.2
71 0.24
72 0.33
73 0.4
74 0.46
75 0.54
76 0.62
77 0.7
78 0.79
79 0.81
80 0.75
81 0.71
82 0.67
83 0.61
84 0.55
85 0.46
86 0.4
87 0.34
88 0.31
89 0.26
90 0.2
91 0.16
92 0.13
93 0.11
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.09
100 0.09
101 0.1
102 0.08
103 0.08
104 0.1
105 0.12
106 0.15
107 0.18
108 0.23
109 0.23
110 0.26
111 0.29
112 0.31
113 0.29
114 0.31
115 0.38