Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FXN3

Protein Details
Accession A0A5C5FXN3   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
185-204SSSARPHRDRPPQPQPPRQSHydrophilic
293-320AVARWIEERKKRWPSKKVVDEKERARAEHydrophilic
NLS Segment(s)
PositionSequence
301-336RKKRWPSKKVVDEKERARAERVAAGLEAPPRGARGR
Subcellular Location(s) cyto_nucl 10.5, mito 7, nucl 17.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039136  NUFIP1-like  
IPR019496  NUFIP1_cons_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF10453  NUFIP1  
Amino Acid Sequences MSHQSSGNQPRRSAPLISRPSARGPPGPPPHPHPHSTLGASIQGALGGMGYHHTAQGYPYPPQPPSTGGYGLGPSHQLGQPQAGYPLHQGAPGTAPYAYAQPSHYAYPPQQQQQQPALSAYPPAPHYPPAHAHHPYPHPHTQPAPTAWQYPGTGASPAPPQTTADGYTLSSTYSGPLPGTASSSSSSARPHRDRPPQPQPPRQSQPSPRPQPSTQQASRAPKKAPPPPPPQTVSCAQPGCGFTGSRKAVREHEEDRHLIFAPGREPKKWDGSLKPKEGAVIEGTGIALDTPEAVARWIEERKKRWPSKKVVDEKERARAERVAAGLEAPPRGARGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.53
4 0.56
5 0.56
6 0.52
7 0.55
8 0.55
9 0.52
10 0.48
11 0.44
12 0.5
13 0.54
14 0.57
15 0.56
16 0.58
17 0.64
18 0.63
19 0.62
20 0.57
21 0.54
22 0.53
23 0.5
24 0.44
25 0.36
26 0.33
27 0.3
28 0.25
29 0.18
30 0.13
31 0.11
32 0.08
33 0.06
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.09
43 0.15
44 0.17
45 0.19
46 0.23
47 0.27
48 0.27
49 0.3
50 0.3
51 0.27
52 0.26
53 0.28
54 0.24
55 0.21
56 0.21
57 0.21
58 0.19
59 0.17
60 0.15
61 0.12
62 0.14
63 0.14
64 0.14
65 0.13
66 0.16
67 0.16
68 0.16
69 0.19
70 0.16
71 0.16
72 0.16
73 0.19
74 0.17
75 0.16
76 0.16
77 0.13
78 0.15
79 0.14
80 0.13
81 0.1
82 0.1
83 0.1
84 0.11
85 0.11
86 0.1
87 0.11
88 0.12
89 0.15
90 0.16
91 0.16
92 0.18
93 0.19
94 0.26
95 0.3
96 0.33
97 0.39
98 0.39
99 0.44
100 0.47
101 0.47
102 0.4
103 0.35
104 0.3
105 0.23
106 0.22
107 0.17
108 0.13
109 0.13
110 0.14
111 0.15
112 0.17
113 0.19
114 0.21
115 0.27
116 0.28
117 0.33
118 0.33
119 0.33
120 0.36
121 0.4
122 0.41
123 0.41
124 0.43
125 0.39
126 0.4
127 0.41
128 0.38
129 0.37
130 0.34
131 0.32
132 0.27
133 0.27
134 0.25
135 0.24
136 0.21
137 0.17
138 0.17
139 0.13
140 0.12
141 0.1
142 0.11
143 0.11
144 0.12
145 0.12
146 0.11
147 0.11
148 0.11
149 0.13
150 0.13
151 0.11
152 0.1
153 0.1
154 0.1
155 0.1
156 0.08
157 0.08
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.06
166 0.08
167 0.08
168 0.08
169 0.09
170 0.1
171 0.1
172 0.11
173 0.14
174 0.17
175 0.24
176 0.28
177 0.33
178 0.41
179 0.51
180 0.57
181 0.63
182 0.7
183 0.73
184 0.77
185 0.8
186 0.77
187 0.76
188 0.76
189 0.72
190 0.69
191 0.68
192 0.69
193 0.71
194 0.73
195 0.69
196 0.68
197 0.64
198 0.64
199 0.63
200 0.62
201 0.53
202 0.51
203 0.54
204 0.57
205 0.62
206 0.58
207 0.53
208 0.49
209 0.55
210 0.57
211 0.59
212 0.58
213 0.61
214 0.63
215 0.68
216 0.67
217 0.61
218 0.57
219 0.5
220 0.44
221 0.41
222 0.35
223 0.29
224 0.29
225 0.27
226 0.25
227 0.23
228 0.21
229 0.15
230 0.24
231 0.26
232 0.26
233 0.28
234 0.29
235 0.33
236 0.38
237 0.43
238 0.4
239 0.43
240 0.45
241 0.44
242 0.42
243 0.39
244 0.34
245 0.28
246 0.25
247 0.2
248 0.2
249 0.27
250 0.29
251 0.28
252 0.31
253 0.35
254 0.41
255 0.44
256 0.45
257 0.47
258 0.55
259 0.63
260 0.65
261 0.62
262 0.54
263 0.52
264 0.46
265 0.38
266 0.29
267 0.2
268 0.15
269 0.13
270 0.12
271 0.1
272 0.09
273 0.07
274 0.05
275 0.03
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.06
282 0.07
283 0.12
284 0.19
285 0.27
286 0.35
287 0.4
288 0.5
289 0.61
290 0.7
291 0.76
292 0.79
293 0.82
294 0.84
295 0.9
296 0.9
297 0.9
298 0.89
299 0.88
300 0.85
301 0.84
302 0.79
303 0.71
304 0.64
305 0.57
306 0.5
307 0.47
308 0.41
309 0.33
310 0.27
311 0.26
312 0.24
313 0.23
314 0.21
315 0.17
316 0.16