Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FWN0

Protein Details
Accession A0A5C5FWN0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
334-362GSAPCCHAHHRARRARLARSPGRRRLVVRHydrophilic
NLS Segment(s)
PositionSequence
344-360RARRARLARSPGRRRLV
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
PROSITE View protein in PROSITE  
PS50020  WW_DOMAIN_2  
Amino Acid Sequences MHQDDELDFGEDELVPQAVPVSSASSLDPSRPGSSTLAPAPSGAAGLAPGGAAGSKGGTTTSRSATAAGSAAPSASHALASSSALPSAASTPPVPPVKAHDETLDALGNKLPAGWVSRVSKSTGNIYYRNTVLNTSAWDIPTEPAAPQPSPPNPASPPTVVPAHPEPAPAVSVLAQAAPAPAPAAPVLAAEQAPAPAAPHPSAQDTQMHDAPSQDPPAAPKARVFVHPDRLKFADPGAVTTQPAAAPAPPTGPAAARGNAMYPARRTSSAAQDPAVVSTPVPASAPPTGPRASFDQRELSFSLRRRRPGSRGRVAATLCTSSRGAWSPSDAPFGSAPCCHAHHRARRARLARSPGRRRLVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.07
4 0.08
5 0.07
6 0.08
7 0.08
8 0.1
9 0.1
10 0.11
11 0.12
12 0.15
13 0.16
14 0.17
15 0.2
16 0.21
17 0.23
18 0.23
19 0.25
20 0.24
21 0.26
22 0.29
23 0.29
24 0.28
25 0.25
26 0.25
27 0.23
28 0.19
29 0.17
30 0.12
31 0.08
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.05
45 0.07
46 0.11
47 0.14
48 0.16
49 0.18
50 0.19
51 0.2
52 0.19
53 0.19
54 0.16
55 0.13
56 0.11
57 0.09
58 0.08
59 0.07
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.07
66 0.08
67 0.09
68 0.1
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.1
75 0.1
76 0.1
77 0.1
78 0.11
79 0.18
80 0.2
81 0.2
82 0.18
83 0.24
84 0.3
85 0.31
86 0.31
87 0.26
88 0.26
89 0.27
90 0.28
91 0.24
92 0.17
93 0.15
94 0.14
95 0.13
96 0.11
97 0.09
98 0.08
99 0.06
100 0.09
101 0.1
102 0.14
103 0.17
104 0.2
105 0.21
106 0.24
107 0.25
108 0.23
109 0.28
110 0.3
111 0.3
112 0.3
113 0.32
114 0.32
115 0.31
116 0.31
117 0.26
118 0.2
119 0.18
120 0.16
121 0.15
122 0.15
123 0.15
124 0.14
125 0.13
126 0.14
127 0.12
128 0.13
129 0.12
130 0.09
131 0.1
132 0.12
133 0.12
134 0.13
135 0.18
136 0.19
137 0.22
138 0.23
139 0.24
140 0.23
141 0.25
142 0.27
143 0.23
144 0.22
145 0.2
146 0.22
147 0.18
148 0.2
149 0.2
150 0.19
151 0.17
152 0.16
153 0.14
154 0.13
155 0.13
156 0.09
157 0.08
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.04
164 0.05
165 0.04
166 0.04
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.07
185 0.07
186 0.08
187 0.09
188 0.12
189 0.13
190 0.14
191 0.17
192 0.17
193 0.2
194 0.22
195 0.22
196 0.19
197 0.2
198 0.2
199 0.18
200 0.17
201 0.13
202 0.11
203 0.12
204 0.19
205 0.2
206 0.18
207 0.18
208 0.2
209 0.21
210 0.25
211 0.3
212 0.29
213 0.37
214 0.41
215 0.41
216 0.42
217 0.42
218 0.4
219 0.33
220 0.29
221 0.23
222 0.19
223 0.21
224 0.19
225 0.18
226 0.16
227 0.16
228 0.16
229 0.11
230 0.12
231 0.09
232 0.07
233 0.08
234 0.08
235 0.09
236 0.09
237 0.1
238 0.1
239 0.1
240 0.13
241 0.15
242 0.15
243 0.15
244 0.14
245 0.14
246 0.18
247 0.19
248 0.18
249 0.17
250 0.19
251 0.21
252 0.22
253 0.25
254 0.24
255 0.33
256 0.36
257 0.37
258 0.34
259 0.33
260 0.32
261 0.3
262 0.28
263 0.18
264 0.12
265 0.12
266 0.12
267 0.1
268 0.1
269 0.09
270 0.1
271 0.13
272 0.16
273 0.16
274 0.2
275 0.21
276 0.21
277 0.24
278 0.27
279 0.31
280 0.32
281 0.33
282 0.37
283 0.36
284 0.39
285 0.38
286 0.35
287 0.35
288 0.39
289 0.46
290 0.45
291 0.51
292 0.54
293 0.59
294 0.65
295 0.69
296 0.73
297 0.72
298 0.73
299 0.69
300 0.69
301 0.63
302 0.57
303 0.5
304 0.43
305 0.33
306 0.3
307 0.27
308 0.21
309 0.24
310 0.23
311 0.22
312 0.2
313 0.25
314 0.26
315 0.27
316 0.32
317 0.29
318 0.28
319 0.27
320 0.27
321 0.25
322 0.21
323 0.22
324 0.2
325 0.24
326 0.26
327 0.34
328 0.42
329 0.49
330 0.59
331 0.67
332 0.72
333 0.79
334 0.82
335 0.81
336 0.81
337 0.81
338 0.8
339 0.82
340 0.83
341 0.83
342 0.83