Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5G341

Protein Details
Accession A0A5C5G341    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-36ASSQSKASAKKKKWSKGKVKDKAQNAVHydrophilic
NLS Segment(s)
PositionSequence
15-30KASAKKKKWSKGKVKD
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPAKAAAAGASSQSKASAKKKKWSKGKVKDKAQNAVICDKPTFDRIMKEVPTFKMISQSVLIERMKINGSLARVAIAHLEKEGLIKPVIHHRAQLVYTRTSGDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.31
4 0.39
5 0.43
6 0.53
7 0.62
8 0.7
9 0.78
10 0.82
11 0.84
12 0.85
13 0.89
14 0.9
15 0.9
16 0.88
17 0.84
18 0.8
19 0.74
20 0.66
21 0.57
22 0.53
23 0.44
24 0.38
25 0.32
26 0.26
27 0.22
28 0.21
29 0.21
30 0.16
31 0.16
32 0.17
33 0.21
34 0.22
35 0.23
36 0.24
37 0.22
38 0.23
39 0.22
40 0.2
41 0.21
42 0.19
43 0.19
44 0.16
45 0.16
46 0.14
47 0.18
48 0.18
49 0.13
50 0.13
51 0.13
52 0.13
53 0.13
54 0.13
55 0.11
56 0.12
57 0.12
58 0.12
59 0.11
60 0.1
61 0.1
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.1
71 0.1
72 0.11
73 0.13
74 0.23
75 0.29
76 0.28
77 0.28
78 0.29
79 0.33
80 0.34
81 0.39
82 0.33
83 0.3
84 0.31
85 0.31