Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5G0K2

Protein Details
Accession A0A5C5G0K2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
109-130VTEAKDKKKEREAQRKSQRASNHydrophilic
NLS Segment(s)
PositionSequence
60-77KKGVSEEVAKKRSRKTVK
112-148AKDKKKEREAQRKSQRASNKPVANAVPKGGKVGRGAR
Subcellular Location(s) mito 10cyto 10cyto_mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEFCNFSGYKIYPGKGKLYIRSDSKIFRFVTSKEESLFLQRKNPRKIAWTTVFRRVNKKGVSEEVAKKRSRKTVKHQRGVVGADAQAILAKRNQQPAVRAAQRAAAVTEAKDKKKEREAQRKSQRASNKPVANAVPKGGKVGRGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.37
4 0.4
5 0.43
6 0.43
7 0.44
8 0.49
9 0.48
10 0.5
11 0.49
12 0.48
13 0.47
14 0.45
15 0.41
16 0.38
17 0.36
18 0.33
19 0.37
20 0.35
21 0.33
22 0.28
23 0.28
24 0.25
25 0.3
26 0.35
27 0.29
28 0.33
29 0.38
30 0.47
31 0.52
32 0.56
33 0.5
34 0.5
35 0.54
36 0.54
37 0.55
38 0.55
39 0.52
40 0.57
41 0.62
42 0.59
43 0.62
44 0.57
45 0.56
46 0.5
47 0.49
48 0.42
49 0.38
50 0.39
51 0.38
52 0.42
53 0.42
54 0.45
55 0.44
56 0.44
57 0.45
58 0.5
59 0.53
60 0.52
61 0.55
62 0.61
63 0.69
64 0.74
65 0.73
66 0.67
67 0.62
68 0.56
69 0.46
70 0.36
71 0.26
72 0.18
73 0.15
74 0.11
75 0.09
76 0.07
77 0.07
78 0.07
79 0.12
80 0.15
81 0.2
82 0.23
83 0.24
84 0.27
85 0.3
86 0.37
87 0.35
88 0.33
89 0.29
90 0.29
91 0.28
92 0.26
93 0.23
94 0.16
95 0.13
96 0.13
97 0.22
98 0.24
99 0.26
100 0.33
101 0.36
102 0.41
103 0.5
104 0.59
105 0.6
106 0.66
107 0.73
108 0.77
109 0.84
110 0.87
111 0.81
112 0.79
113 0.78
114 0.75
115 0.75
116 0.74
117 0.69
118 0.62
119 0.64
120 0.61
121 0.57
122 0.51
123 0.46
124 0.41
125 0.35
126 0.38
127 0.34
128 0.33