Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FZI7

Protein Details
Accession A0A5C5FZI7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-72AKNTSARRRSCSPRKTRRVPMQRTCWQPRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 3, extr 3, mito 5, nucl 14
Family & Domain DBs
Amino Acid Sequences MSSVGSCLAALLQSAEACLTLAASPQRSSATRMPAWPICWPAKNTSARRRSCSPRKTRRVPMQRTCWQPRLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.04
8 0.07
9 0.09
10 0.1
11 0.11
12 0.12
13 0.14
14 0.14
15 0.2
16 0.21
17 0.25
18 0.25
19 0.26
20 0.29
21 0.28
22 0.29
23 0.26
24 0.26
25 0.22
26 0.23
27 0.24
28 0.23
29 0.29
30 0.36
31 0.42
32 0.48
33 0.55
34 0.56
35 0.61
36 0.64
37 0.67
38 0.7
39 0.73
40 0.74
41 0.76
42 0.82
43 0.85
44 0.89
45 0.9
46 0.9
47 0.9
48 0.89
49 0.88
50 0.86
51 0.87
52 0.85
53 0.82