Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FPE1

Protein Details
Accession A0A5C5FPE1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
286-317GGRTRRTCMARRRTTRASRRSSSRTRRAQGGTHydrophilic
NLS Segment(s)
PositionSequence
302-305ASRR
Subcellular Location(s) cyto 10.5, nucl 9, cyto_mito 7, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004821  Cyt_trans-like  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
Amino Acid Sequences MSHDPSDRFLVLSFPSISHWVTLPRATSSSSPLSSHLDAVHHAAQQTTQSLTVVIRTPSDAPSPWRNPSAPTTSSPPLSSSPSSDPSLSPTALFLPLEQALARVYNAATSAFFASDDGPLKNVDVVVEQLRDISRVCIPQDAQVDRWEWTDAAAEGDGKGKGKADGARAPPPPPEAGASSGLPPLYPVVALGGTFDHLHAGHKILLTMACSLCSQRLVVGVSDDHLLVNKKYRHLVQSLDERLAAVTRFVALVRPAIECDAVPLQVRPSRADLARFPWLGAGLTLGGRTRRTCMARRRTTRASRRSSSRTRRAQGGTRVSLSLPHSLCPGSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.21
5 0.19
6 0.19
7 0.19
8 0.21
9 0.23
10 0.23
11 0.23
12 0.24
13 0.25
14 0.25
15 0.27
16 0.29
17 0.29
18 0.28
19 0.28
20 0.32
21 0.3
22 0.3
23 0.27
24 0.22
25 0.21
26 0.25
27 0.25
28 0.21
29 0.2
30 0.19
31 0.18
32 0.18
33 0.19
34 0.15
35 0.13
36 0.11
37 0.12
38 0.12
39 0.14
40 0.15
41 0.14
42 0.14
43 0.15
44 0.17
45 0.18
46 0.21
47 0.2
48 0.22
49 0.31
50 0.36
51 0.38
52 0.4
53 0.39
54 0.4
55 0.43
56 0.44
57 0.38
58 0.36
59 0.38
60 0.37
61 0.38
62 0.35
63 0.32
64 0.28
65 0.3
66 0.27
67 0.25
68 0.26
69 0.28
70 0.3
71 0.28
72 0.26
73 0.26
74 0.28
75 0.24
76 0.2
77 0.16
78 0.16
79 0.16
80 0.16
81 0.11
82 0.1
83 0.11
84 0.11
85 0.1
86 0.09
87 0.08
88 0.09
89 0.09
90 0.07
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.07
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.09
103 0.11
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.09
110 0.07
111 0.06
112 0.08
113 0.09
114 0.09
115 0.08
116 0.09
117 0.09
118 0.1
119 0.09
120 0.1
121 0.1
122 0.12
123 0.12
124 0.14
125 0.14
126 0.18
127 0.23
128 0.23
129 0.22
130 0.22
131 0.23
132 0.21
133 0.21
134 0.17
135 0.12
136 0.11
137 0.11
138 0.09
139 0.08
140 0.07
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.1
150 0.12
151 0.14
152 0.19
153 0.22
154 0.28
155 0.29
156 0.29
157 0.28
158 0.27
159 0.24
160 0.19
161 0.17
162 0.12
163 0.13
164 0.14
165 0.14
166 0.13
167 0.13
168 0.12
169 0.11
170 0.09
171 0.07
172 0.06
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.07
186 0.07
187 0.09
188 0.09
189 0.09
190 0.09
191 0.09
192 0.09
193 0.09
194 0.11
195 0.09
196 0.09
197 0.09
198 0.1
199 0.1
200 0.1
201 0.09
202 0.07
203 0.09
204 0.1
205 0.1
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.08
212 0.09
213 0.1
214 0.1
215 0.17
216 0.19
217 0.21
218 0.25
219 0.28
220 0.3
221 0.31
222 0.34
223 0.32
224 0.39
225 0.39
226 0.37
227 0.33
228 0.3
229 0.27
230 0.25
231 0.19
232 0.1
233 0.07
234 0.06
235 0.07
236 0.07
237 0.08
238 0.08
239 0.1
240 0.11
241 0.11
242 0.12
243 0.12
244 0.13
245 0.11
246 0.13
247 0.12
248 0.12
249 0.12
250 0.12
251 0.16
252 0.18
253 0.2
254 0.19
255 0.22
256 0.26
257 0.28
258 0.31
259 0.3
260 0.32
261 0.38
262 0.36
263 0.32
264 0.28
265 0.26
266 0.22
267 0.19
268 0.15
269 0.09
270 0.09
271 0.09
272 0.1
273 0.12
274 0.14
275 0.16
276 0.18
277 0.25
278 0.31
279 0.39
280 0.47
281 0.56
282 0.64
283 0.72
284 0.77
285 0.8
286 0.85
287 0.87
288 0.86
289 0.85
290 0.82
291 0.83
292 0.84
293 0.84
294 0.84
295 0.84
296 0.85
297 0.81
298 0.81
299 0.79
300 0.78
301 0.77
302 0.76
303 0.71
304 0.63
305 0.59
306 0.5
307 0.48
308 0.41
309 0.4
310 0.31
311 0.26
312 0.26
313 0.26