Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FW25

Protein Details
Accession A0A5C5FW25   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-98KNVPHRLRVRLHRKRNDNEDAPBasic
NLS Segment(s)
Subcellular Location(s) cyto 6, mito 19
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MARGQKNTERKTRSALTDVVAREYTIHLHTKVHGEGFKHRAPSAVKAVRTFAQKAMGTKKVLLEPSVNEAIWGKGIKNVPHRLRVRLHRKRNDNEDAPADEKLYTQVSVVPTTDFKGLQTTVVDAEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.5
3 0.43
4 0.42
5 0.4
6 0.36
7 0.3
8 0.25
9 0.21
10 0.2
11 0.19
12 0.16
13 0.19
14 0.16
15 0.17
16 0.18
17 0.21
18 0.22
19 0.23
20 0.22
21 0.21
22 0.27
23 0.32
24 0.33
25 0.32
26 0.3
27 0.32
28 0.31
29 0.34
30 0.36
31 0.35
32 0.34
33 0.32
34 0.35
35 0.34
36 0.35
37 0.32
38 0.23
39 0.24
40 0.24
41 0.26
42 0.29
43 0.29
44 0.27
45 0.26
46 0.27
47 0.23
48 0.22
49 0.21
50 0.16
51 0.13
52 0.16
53 0.17
54 0.15
55 0.12
56 0.12
57 0.11
58 0.12
59 0.11
60 0.07
61 0.1
62 0.13
63 0.17
64 0.24
65 0.33
66 0.35
67 0.44
68 0.46
69 0.47
70 0.52
71 0.59
72 0.63
73 0.64
74 0.72
75 0.72
76 0.79
77 0.81
78 0.83
79 0.81
80 0.74
81 0.67
82 0.61
83 0.56
84 0.48
85 0.41
86 0.33
87 0.24
88 0.21
89 0.18
90 0.16
91 0.12
92 0.1
93 0.13
94 0.14
95 0.16
96 0.16
97 0.16
98 0.15
99 0.17
100 0.19
101 0.16
102 0.14
103 0.17
104 0.17
105 0.17
106 0.17
107 0.17
108 0.16