Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FUH4

Protein Details
Accession A0A5C5FUH4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
170-198ARPLPKFITLPRRRRRRRVVRPADPNAAPHydrophilic
NLS Segment(s)
PositionSequence
180-190PRRRRRRRVVR
Subcellular Location(s) cyto 4, mito 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MPRKLEFTAPGVQARDRAWKRQYFVLHGTSIKIFKYDLRSHPLPGEDDWSVVPADIAGHDGPPPLHFHEGEYGVEQPGQGHRFSIELAKAKAKDRIIASATASAENALVRHYSLQHAESGLAADYLKRKHVVRVRAEGEQFLLQAKDDRGVIDLIEALQAATNVALDLDARPLPKFITLPRRRRRRRVVRPADPNAAPAAEGAAAGTAAGAAAGTAAAPRGPDRMGDMLAEEQVRAPPNLLSCAPAGLTLASLRRTPTRAATAAPSCKPLVTATAAKHYKKPRNLYMPVPLAAAAAHSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.37
4 0.43
5 0.47
6 0.51
7 0.53
8 0.57
9 0.6
10 0.56
11 0.58
12 0.54
13 0.49
14 0.43
15 0.42
16 0.38
17 0.35
18 0.28
19 0.23
20 0.19
21 0.2
22 0.28
23 0.33
24 0.36
25 0.43
26 0.44
27 0.46
28 0.48
29 0.47
30 0.4
31 0.34
32 0.33
33 0.24
34 0.23
35 0.21
36 0.18
37 0.16
38 0.13
39 0.11
40 0.07
41 0.07
42 0.06
43 0.08
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.13
51 0.14
52 0.17
53 0.16
54 0.17
55 0.21
56 0.22
57 0.22
58 0.2
59 0.18
60 0.16
61 0.16
62 0.14
63 0.11
64 0.14
65 0.15
66 0.14
67 0.13
68 0.13
69 0.13
70 0.14
71 0.16
72 0.16
73 0.18
74 0.2
75 0.25
76 0.27
77 0.28
78 0.33
79 0.3
80 0.31
81 0.28
82 0.31
83 0.28
84 0.27
85 0.26
86 0.24
87 0.24
88 0.2
89 0.18
90 0.13
91 0.12
92 0.1
93 0.09
94 0.06
95 0.06
96 0.05
97 0.07
98 0.07
99 0.09
100 0.11
101 0.11
102 0.11
103 0.11
104 0.11
105 0.1
106 0.1
107 0.08
108 0.06
109 0.06
110 0.06
111 0.09
112 0.1
113 0.11
114 0.13
115 0.14
116 0.21
117 0.27
118 0.34
119 0.36
120 0.43
121 0.44
122 0.46
123 0.46
124 0.39
125 0.34
126 0.26
127 0.21
128 0.14
129 0.11
130 0.07
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.06
140 0.06
141 0.05
142 0.05
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.05
156 0.06
157 0.07
158 0.07
159 0.08
160 0.08
161 0.09
162 0.1
163 0.14
164 0.24
165 0.33
166 0.44
167 0.53
168 0.64
169 0.71
170 0.8
171 0.86
172 0.86
173 0.88
174 0.89
175 0.91
176 0.89
177 0.91
178 0.87
179 0.82
180 0.7
181 0.6
182 0.49
183 0.38
184 0.28
185 0.18
186 0.12
187 0.06
188 0.06
189 0.05
190 0.04
191 0.03
192 0.03
193 0.03
194 0.02
195 0.02
196 0.02
197 0.02
198 0.01
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.04
206 0.04
207 0.06
208 0.07
209 0.07
210 0.11
211 0.12
212 0.13
213 0.13
214 0.13
215 0.13
216 0.14
217 0.14
218 0.11
219 0.1
220 0.12
221 0.13
222 0.12
223 0.12
224 0.12
225 0.14
226 0.17
227 0.17
228 0.16
229 0.14
230 0.15
231 0.14
232 0.12
233 0.11
234 0.08
235 0.08
236 0.09
237 0.11
238 0.12
239 0.13
240 0.15
241 0.19
242 0.21
243 0.23
244 0.27
245 0.31
246 0.31
247 0.32
248 0.37
249 0.41
250 0.45
251 0.44
252 0.42
253 0.36
254 0.34
255 0.33
256 0.27
257 0.23
258 0.22
259 0.26
260 0.25
261 0.35
262 0.41
263 0.42
264 0.49
265 0.56
266 0.6
267 0.64
268 0.71
269 0.71
270 0.74
271 0.77
272 0.76
273 0.75
274 0.71
275 0.63
276 0.54
277 0.44
278 0.34
279 0.28