Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FRC0

Protein Details
Accession A0A5C5FRC0   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
260-287LSTSSPKYASRPSKRKRRTESEDQVLGPHydrophilic
NLS Segment(s)
PositionSequence
265-296PKYASRPSKRKRRTESEDQVLGPPRGAKRARR
Subcellular Location(s) cyto 4, extr 15, mito_nucl 4, nucl 6
Family & Domain DBs
Amino Acid Sequences MTSPTAKTLGCATSLLALAEFDAPYAPPVEMRSSTVRSCLGNIDDGRCGACGAWVVGAATWTLPGDYCDVWTPDWSRCTTFADCHVDPTGRLTRFPSTLTLPAAPSSSPTSHEALFPPPFAAPPSFITHLPPPLFAPPSFPDPGARWRANLRGEYPFGALDASTPSPLAPARPLDALSGMDESAPHESLLVRLRTGRSTSASAPGEFGEGVYGGGDGDDGTGRGDGPSPRRDSSTATLASLWGSVSLGAAAGKENARPRLSTSSPKYASRPSKRKRRTESEDQVLGPPRGAKRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.12
4 0.11
5 0.1
6 0.11
7 0.1
8 0.08
9 0.08
10 0.08
11 0.08
12 0.1
13 0.09
14 0.08
15 0.11
16 0.15
17 0.16
18 0.2
19 0.24
20 0.28
21 0.28
22 0.3
23 0.31
24 0.27
25 0.27
26 0.27
27 0.23
28 0.26
29 0.27
30 0.26
31 0.25
32 0.24
33 0.24
34 0.2
35 0.18
36 0.12
37 0.11
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.08
53 0.08
54 0.09
55 0.11
56 0.13
57 0.13
58 0.16
59 0.18
60 0.19
61 0.22
62 0.23
63 0.22
64 0.23
65 0.28
66 0.27
67 0.26
68 0.29
69 0.33
70 0.32
71 0.32
72 0.33
73 0.28
74 0.26
75 0.29
76 0.3
77 0.23
78 0.24
79 0.24
80 0.25
81 0.26
82 0.27
83 0.24
84 0.2
85 0.22
86 0.23
87 0.21
88 0.19
89 0.18
90 0.18
91 0.15
92 0.14
93 0.15
94 0.13
95 0.15
96 0.17
97 0.18
98 0.18
99 0.19
100 0.18
101 0.2
102 0.2
103 0.17
104 0.15
105 0.14
106 0.13
107 0.14
108 0.13
109 0.1
110 0.12
111 0.15
112 0.16
113 0.17
114 0.19
115 0.19
116 0.23
117 0.22
118 0.19
119 0.17
120 0.18
121 0.19
122 0.16
123 0.19
124 0.16
125 0.2
126 0.2
127 0.19
128 0.18
129 0.18
130 0.24
131 0.27
132 0.25
133 0.22
134 0.24
135 0.29
136 0.3
137 0.29
138 0.26
139 0.23
140 0.24
141 0.23
142 0.22
143 0.17
144 0.14
145 0.12
146 0.09
147 0.06
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.1
159 0.1
160 0.11
161 0.1
162 0.11
163 0.11
164 0.1
165 0.09
166 0.08
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.07
173 0.07
174 0.07
175 0.1
176 0.15
177 0.14
178 0.13
179 0.15
180 0.16
181 0.18
182 0.2
183 0.2
184 0.18
185 0.2
186 0.21
187 0.26
188 0.27
189 0.24
190 0.23
191 0.21
192 0.19
193 0.16
194 0.14
195 0.07
196 0.06
197 0.06
198 0.05
199 0.05
200 0.03
201 0.03
202 0.04
203 0.03
204 0.03
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.08
212 0.12
213 0.17
214 0.24
215 0.28
216 0.29
217 0.32
218 0.34
219 0.36
220 0.37
221 0.39
222 0.33
223 0.3
224 0.28
225 0.26
226 0.25
227 0.19
228 0.15
229 0.08
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.08
239 0.08
240 0.12
241 0.18
242 0.23
243 0.25
244 0.26
245 0.3
246 0.36
247 0.4
248 0.46
249 0.48
250 0.53
251 0.55
252 0.58
253 0.58
254 0.6
255 0.66
256 0.67
257 0.71
258 0.71
259 0.78
260 0.84
261 0.91
262 0.91
263 0.91
264 0.89
265 0.89
266 0.89
267 0.87
268 0.83
269 0.74
270 0.7
271 0.65
272 0.56
273 0.47
274 0.42
275 0.35
276 0.38