Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FQI3

Protein Details
Accession A0A5C5FQI3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-36ARSGARRRRANGQTNRRTRSSHydrophilic
NLS Segment(s)
PositionSequence
17-27RSGARRRRANG
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MDCLEDARGVAGPSGARSGARRRRANGQTNRRTRSSRSSTLPRACSVRPTAPSPPRRGTHRIGDIATVIIRPHTWCIDLDKYNTVARTQLPLQLAWALTIHKSQGQSLDAVGVRLTNTFEKGQCVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.14
5 0.25
6 0.32
7 0.42
8 0.47
9 0.49
10 0.59
11 0.67
12 0.74
13 0.74
14 0.76
15 0.77
16 0.81
17 0.82
18 0.76
19 0.71
20 0.65
21 0.64
22 0.61
23 0.58
24 0.55
25 0.59
26 0.64
27 0.67
28 0.64
29 0.56
30 0.52
31 0.46
32 0.43
33 0.39
34 0.35
35 0.31
36 0.32
37 0.38
38 0.43
39 0.49
40 0.5
41 0.51
42 0.5
43 0.53
44 0.54
45 0.49
46 0.48
47 0.47
48 0.43
49 0.38
50 0.35
51 0.29
52 0.24
53 0.2
54 0.13
55 0.08
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.08
62 0.09
63 0.14
64 0.19
65 0.2
66 0.22
67 0.22
68 0.24
69 0.24
70 0.24
71 0.2
72 0.17
73 0.15
74 0.18
75 0.17
76 0.19
77 0.18
78 0.18
79 0.18
80 0.19
81 0.18
82 0.14
83 0.14
84 0.1
85 0.1
86 0.11
87 0.11
88 0.12
89 0.13
90 0.14
91 0.17
92 0.17
93 0.17
94 0.16
95 0.2
96 0.17
97 0.16
98 0.15
99 0.12
100 0.11
101 0.11
102 0.14
103 0.12
104 0.15
105 0.18
106 0.19