Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FYG5

Protein Details
Accession A0A5C5FYG5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
128-154AGSTPRRQPRTPRPPRARRPRPGSGPTBasic
199-227VSRPLAAGPGRRRRRRERPNRARSSTSTVHydrophilic
NLS Segment(s)
PositionSequence
122-221LTRRRLAGSTPRRQPRTPRPPRARRPRPGSGPTTTPSWKEEGRAKGGASREARNEARKGRQGRRVSSAGWVTRRPPGVSRPLAAGPGRRRRRRERPNRAR
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MGRVARLRSSDKQRVRLVVERDKRESEPVLVHCPAARPATVRRRGPCTTSTRAAAPRALRLSVPRSRTAHDLSYSTITRKLSAAADPSIRDRALCVPPRCSLSTLLLLLPPDLVTNRALRPLTRRRLAGSTPRRQPRTPRPPRARRPRPGSGPTTTPSWKEEGRAKGGASREARNEARKGRQGRRVSSAGWVTRRPPGVSRPLAAGPGRRRRRRERPNRARSSTSTVGFARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.68
4 0.66
5 0.66
6 0.67
7 0.66
8 0.66
9 0.64
10 0.6
11 0.57
12 0.51
13 0.44
14 0.41
15 0.38
16 0.39
17 0.36
18 0.34
19 0.3
20 0.3
21 0.3
22 0.25
23 0.22
24 0.19
25 0.27
26 0.37
27 0.45
28 0.5
29 0.51
30 0.56
31 0.58
32 0.59
33 0.57
34 0.54
35 0.53
36 0.5
37 0.47
38 0.45
39 0.46
40 0.44
41 0.41
42 0.36
43 0.35
44 0.33
45 0.32
46 0.28
47 0.28
48 0.32
49 0.33
50 0.35
51 0.35
52 0.35
53 0.37
54 0.41
55 0.4
56 0.37
57 0.33
58 0.31
59 0.27
60 0.29
61 0.27
62 0.24
63 0.24
64 0.2
65 0.19
66 0.18
67 0.18
68 0.15
69 0.16
70 0.17
71 0.16
72 0.17
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.14
79 0.17
80 0.23
81 0.3
82 0.3
83 0.31
84 0.33
85 0.36
86 0.36
87 0.32
88 0.27
89 0.21
90 0.22
91 0.19
92 0.17
93 0.15
94 0.14
95 0.12
96 0.1
97 0.08
98 0.06
99 0.05
100 0.06
101 0.06
102 0.08
103 0.08
104 0.12
105 0.12
106 0.13
107 0.2
108 0.28
109 0.35
110 0.36
111 0.37
112 0.36
113 0.39
114 0.42
115 0.45
116 0.45
117 0.47
118 0.52
119 0.59
120 0.61
121 0.59
122 0.65
123 0.66
124 0.68
125 0.7
126 0.73
127 0.76
128 0.82
129 0.91
130 0.93
131 0.92
132 0.91
133 0.88
134 0.86
135 0.83
136 0.79
137 0.74
138 0.65
139 0.59
140 0.51
141 0.48
142 0.4
143 0.33
144 0.29
145 0.27
146 0.24
147 0.24
148 0.3
149 0.3
150 0.33
151 0.33
152 0.32
153 0.33
154 0.34
155 0.37
156 0.33
157 0.32
158 0.29
159 0.34
160 0.38
161 0.39
162 0.43
163 0.42
164 0.47
165 0.51
166 0.57
167 0.59
168 0.65
169 0.67
170 0.66
171 0.67
172 0.62
173 0.55
174 0.53
175 0.51
176 0.47
177 0.44
178 0.42
179 0.37
180 0.41
181 0.43
182 0.39
183 0.36
184 0.37
185 0.42
186 0.43
187 0.42
188 0.41
189 0.39
190 0.41
191 0.39
192 0.41
193 0.41
194 0.48
195 0.57
196 0.62
197 0.69
198 0.75
199 0.84
200 0.88
201 0.89
202 0.9
203 0.91
204 0.93
205 0.95
206 0.92
207 0.87
208 0.82
209 0.79
210 0.75
211 0.65
212 0.59