Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FVG9

Protein Details
Accession A0A5C5FVG9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-119GQYHGPPKRCKSNTRCRCRCSRDSFSFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 3, cyto_nucl 13, mito 3, nucl 21
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd00590  RRM_SF  
Amino Acid Sequences NPGNNLHVSGLSLRVEERDLEELFSKHGRIQKCQVMRDPHSKESRGFAFVTMETVEDAEAAISALSATELMGRTMNVEKARRGRARTPTPGQYHGPPKRCKSNTRCRCRCSRDSFSFRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.15
5 0.16
6 0.15
7 0.17
8 0.19
9 0.18
10 0.2
11 0.2
12 0.18
13 0.18
14 0.23
15 0.24
16 0.27
17 0.33
18 0.39
19 0.43
20 0.47
21 0.5
22 0.53
23 0.56
24 0.6
25 0.59
26 0.59
27 0.58
28 0.56
29 0.5
30 0.47
31 0.43
32 0.35
33 0.3
34 0.23
35 0.19
36 0.17
37 0.17
38 0.12
39 0.1
40 0.08
41 0.07
42 0.07
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.07
61 0.09
62 0.12
63 0.15
64 0.17
65 0.21
66 0.27
67 0.36
68 0.39
69 0.43
70 0.47
71 0.53
72 0.6
73 0.64
74 0.65
75 0.65
76 0.64
77 0.64
78 0.6
79 0.57
80 0.59
81 0.59
82 0.61
83 0.6
84 0.62
85 0.69
86 0.71
87 0.74
88 0.74
89 0.77
90 0.79
91 0.83
92 0.85
93 0.81
94 0.86
95 0.85
96 0.85
97 0.83
98 0.83
99 0.82