Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FKS3

Protein Details
Accession A0A5C5FKS3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-150ATSPPPWRRRPCQPRAHRTRPTRAPAHydrophilic
173-198AVQVPRAACRRPRRRRGGRGCRVLCGHydrophilic
NLS Segment(s)
PositionSequence
129-159PPWRRRPCQPRAHRTRPTRAPANPAPRSRRP
182-190RRPRRRRGG
Subcellular Location(s) cyto 4, extr 3, mito 12, nucl 7
Family & Domain DBs
Amino Acid Sequences MSFLSVVSVRVRGPASSTVNSESGHVGQCASLSRVSSGVPWPQLIRSARNEVGARPRDVPPASLSALAQRRPEAEGGRADSESAPRPKCRLRGALPVCLVPRLGHRITCSLPRLQRSTGASRPPATSPPPWRRRPCQPRAHRTRPTRAPANPAPRSRRPQPHIALQPPGETTAVQVPRAACRRPRRRRGGRGCRVLCGALRSAILVQPQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.29
4 0.32
5 0.31
6 0.32
7 0.32
8 0.3
9 0.25
10 0.22
11 0.21
12 0.18
13 0.15
14 0.13
15 0.13
16 0.14
17 0.13
18 0.13
19 0.12
20 0.12
21 0.13
22 0.13
23 0.14
24 0.16
25 0.19
26 0.19
27 0.19
28 0.2
29 0.2
30 0.26
31 0.27
32 0.28
33 0.29
34 0.34
35 0.34
36 0.38
37 0.38
38 0.35
39 0.42
40 0.41
41 0.38
42 0.35
43 0.35
44 0.36
45 0.36
46 0.34
47 0.26
48 0.25
49 0.24
50 0.21
51 0.2
52 0.21
53 0.24
54 0.25
55 0.24
56 0.22
57 0.22
58 0.22
59 0.25
60 0.19
61 0.18
62 0.19
63 0.2
64 0.21
65 0.2
66 0.19
67 0.17
68 0.18
69 0.21
70 0.23
71 0.23
72 0.23
73 0.27
74 0.3
75 0.36
76 0.38
77 0.4
78 0.38
79 0.46
80 0.48
81 0.5
82 0.47
83 0.43
84 0.39
85 0.32
86 0.28
87 0.17
88 0.16
89 0.16
90 0.15
91 0.14
92 0.15
93 0.18
94 0.19
95 0.23
96 0.23
97 0.22
98 0.25
99 0.27
100 0.29
101 0.27
102 0.3
103 0.3
104 0.34
105 0.34
106 0.35
107 0.34
108 0.33
109 0.34
110 0.31
111 0.3
112 0.27
113 0.29
114 0.35
115 0.43
116 0.5
117 0.57
118 0.63
119 0.66
120 0.74
121 0.78
122 0.78
123 0.79
124 0.8
125 0.82
126 0.86
127 0.89
128 0.88
129 0.85
130 0.85
131 0.83
132 0.8
133 0.77
134 0.69
135 0.67
136 0.66
137 0.69
138 0.66
139 0.65
140 0.65
141 0.66
142 0.7
143 0.71
144 0.73
145 0.68
146 0.7
147 0.67
148 0.69
149 0.7
150 0.67
151 0.64
152 0.54
153 0.51
154 0.42
155 0.38
156 0.29
157 0.2
158 0.17
159 0.2
160 0.21
161 0.19
162 0.21
163 0.2
164 0.28
165 0.33
166 0.36
167 0.37
168 0.46
169 0.57
170 0.66
171 0.76
172 0.79
173 0.85
174 0.92
175 0.94
176 0.95
177 0.94
178 0.94
179 0.86
180 0.79
181 0.71
182 0.62
183 0.53
184 0.46
185 0.37
186 0.28
187 0.26
188 0.22
189 0.21
190 0.2
191 0.24