Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5G3H5

Protein Details
Accession A0A5C5G3H5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
396-440VTAAPTKKKPPPSPRKAPPSPHKAPPSPRKTPPLPRKTPPSPRKAHydrophilic
NLS Segment(s)
PositionSequence
192-197AKGKGK
401-460TKKKPPPSPRKAPPSPHKAPPSPRKTPPLPRKTPPSPRKAPLAPQQPPPPPHKAPPSPRK
499-502AKKR
Subcellular Location(s) cyto 8, mito 7, extr 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR003000  Sirtuin  
IPR026591  Sirtuin_cat_small_dom_sf  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0070403  F:NAD+ binding  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF02146  SIR2  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
Amino Acid Sequences MQTLSLPRPGAVDEDKATTKALDSVALAVARSKRTVLLVGAGISTNAGIPDFRSPGSGLYSPPSESSSASPRPASTFVTPPSTLKGPALFSASVYSSPDTTAEHLRFVAAFKRSLDTITRNSSSPPSSPRTVQRPVTPTHDFMRLLKKRNKLLRVYTQNIDGLEGVGTGLAPVALAGITPCASSAPGLPAKAKGKGKAKVEGDYVQLHGAVHAVRCTGCDFVRAWSDEDGEAFAGGSVGACPQCEERASIRLARGQRTLSSLSRAFLRPSITLYNESPPASSASTIGSLSLSDLSASPGPDVMLVMGTSLRIPGFKKLVKEFARSVKSRGGVRVLVNREEIGSKSEWRDVFDYQVLGDTDAFVTRLTGDWKRLRPQDWTGTQATLGPLFASSKAAVTAAPTKKKPPPSPRKAPPSPHKAPPSPRKTPPLPRKTPPSPRKAPLAPQQPPPPPHKAPPSPRKPLFSLCLNSPSRPPAPALAPAPKVAPPPVIAPAPAPAPAKKRLPAPPSPAPPSVDANLSAEHPAHDAQLAPRCGGLDVPGLFAAAAVAPEPVCERAGVAIEGGREPGVDREGVCAAPAEGEGTIAGAERGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.29
5 0.24
6 0.21
7 0.2
8 0.19
9 0.15
10 0.14
11 0.15
12 0.17
13 0.17
14 0.16
15 0.17
16 0.2
17 0.21
18 0.22
19 0.21
20 0.2
21 0.22
22 0.24
23 0.21
24 0.21
25 0.2
26 0.2
27 0.19
28 0.18
29 0.15
30 0.13
31 0.11
32 0.08
33 0.06
34 0.06
35 0.05
36 0.07
37 0.12
38 0.14
39 0.14
40 0.16
41 0.16
42 0.18
43 0.23
44 0.23
45 0.19
46 0.21
47 0.23
48 0.22
49 0.23
50 0.23
51 0.19
52 0.19
53 0.22
54 0.26
55 0.28
56 0.3
57 0.31
58 0.3
59 0.33
60 0.34
61 0.34
62 0.3
63 0.32
64 0.32
65 0.36
66 0.36
67 0.33
68 0.36
69 0.33
70 0.3
71 0.26
72 0.26
73 0.22
74 0.23
75 0.25
76 0.2
77 0.19
78 0.2
79 0.19
80 0.17
81 0.17
82 0.16
83 0.13
84 0.13
85 0.14
86 0.13
87 0.14
88 0.21
89 0.2
90 0.2
91 0.2
92 0.2
93 0.2
94 0.2
95 0.23
96 0.18
97 0.19
98 0.19
99 0.22
100 0.21
101 0.23
102 0.26
103 0.25
104 0.28
105 0.33
106 0.34
107 0.32
108 0.34
109 0.36
110 0.34
111 0.33
112 0.33
113 0.32
114 0.34
115 0.38
116 0.43
117 0.47
118 0.51
119 0.52
120 0.53
121 0.52
122 0.52
123 0.54
124 0.5
125 0.46
126 0.41
127 0.42
128 0.36
129 0.35
130 0.43
131 0.42
132 0.47
133 0.51
134 0.56
135 0.59
136 0.67
137 0.71
138 0.67
139 0.7
140 0.71
141 0.73
142 0.71
143 0.64
144 0.58
145 0.52
146 0.45
147 0.37
148 0.26
149 0.18
150 0.12
151 0.1
152 0.07
153 0.05
154 0.04
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.11
173 0.13
174 0.14
175 0.15
176 0.2
177 0.22
178 0.29
179 0.31
180 0.33
181 0.39
182 0.45
183 0.48
184 0.5
185 0.5
186 0.46
187 0.46
188 0.42
189 0.36
190 0.31
191 0.28
192 0.2
193 0.18
194 0.15
195 0.11
196 0.1
197 0.08
198 0.07
199 0.07
200 0.07
201 0.07
202 0.08
203 0.09
204 0.1
205 0.09
206 0.11
207 0.11
208 0.13
209 0.17
210 0.17
211 0.18
212 0.17
213 0.18
214 0.16
215 0.15
216 0.14
217 0.1
218 0.08
219 0.06
220 0.05
221 0.04
222 0.03
223 0.03
224 0.03
225 0.04
226 0.04
227 0.04
228 0.05
229 0.06
230 0.07
231 0.08
232 0.1
233 0.11
234 0.15
235 0.16
236 0.18
237 0.18
238 0.22
239 0.25
240 0.25
241 0.26
242 0.23
243 0.23
244 0.24
245 0.26
246 0.22
247 0.24
248 0.22
249 0.2
250 0.21
251 0.21
252 0.19
253 0.18
254 0.19
255 0.15
256 0.17
257 0.19
258 0.17
259 0.19
260 0.19
261 0.2
262 0.19
263 0.19
264 0.16
265 0.15
266 0.15
267 0.12
268 0.11
269 0.09
270 0.08
271 0.09
272 0.08
273 0.08
274 0.06
275 0.06
276 0.06
277 0.06
278 0.05
279 0.04
280 0.04
281 0.06
282 0.06
283 0.07
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.04
290 0.04
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.04
297 0.04
298 0.05
299 0.06
300 0.09
301 0.14
302 0.16
303 0.19
304 0.21
305 0.3
306 0.32
307 0.35
308 0.36
309 0.39
310 0.44
311 0.41
312 0.42
313 0.37
314 0.38
315 0.36
316 0.34
317 0.29
318 0.25
319 0.26
320 0.31
321 0.29
322 0.27
323 0.26
324 0.24
325 0.21
326 0.19
327 0.18
328 0.13
329 0.12
330 0.12
331 0.14
332 0.18
333 0.18
334 0.19
335 0.21
336 0.19
337 0.2
338 0.19
339 0.18
340 0.13
341 0.15
342 0.13
343 0.11
344 0.1
345 0.08
346 0.07
347 0.07
348 0.07
349 0.05
350 0.05
351 0.05
352 0.06
353 0.09
354 0.11
355 0.17
356 0.23
357 0.28
358 0.35
359 0.39
360 0.4
361 0.42
362 0.46
363 0.48
364 0.45
365 0.45
366 0.4
367 0.36
368 0.34
369 0.3
370 0.25
371 0.16
372 0.13
373 0.08
374 0.07
375 0.07
376 0.08
377 0.08
378 0.07
379 0.07
380 0.08
381 0.08
382 0.07
383 0.09
384 0.17
385 0.22
386 0.28
387 0.29
388 0.34
389 0.4
390 0.5
391 0.57
392 0.6
393 0.65
394 0.69
395 0.79
396 0.83
397 0.87
398 0.85
399 0.86
400 0.84
401 0.83
402 0.79
403 0.77
404 0.75
405 0.72
406 0.74
407 0.75
408 0.74
409 0.72
410 0.72
411 0.72
412 0.72
413 0.76
414 0.77
415 0.77
416 0.76
417 0.74
418 0.77
419 0.79
420 0.82
421 0.8
422 0.79
423 0.77
424 0.73
425 0.75
426 0.69
427 0.67
428 0.66
429 0.67
430 0.62
431 0.61
432 0.66
433 0.65
434 0.65
435 0.62
436 0.61
437 0.55
438 0.57
439 0.59
440 0.61
441 0.64
442 0.71
443 0.75
444 0.77
445 0.77
446 0.76
447 0.7
448 0.66
449 0.61
450 0.57
451 0.51
452 0.44
453 0.48
454 0.46
455 0.43
456 0.4
457 0.41
458 0.35
459 0.33
460 0.31
461 0.26
462 0.26
463 0.31
464 0.32
465 0.33
466 0.33
467 0.32
468 0.32
469 0.3
470 0.3
471 0.26
472 0.23
473 0.18
474 0.19
475 0.22
476 0.21
477 0.19
478 0.18
479 0.18
480 0.17
481 0.2
482 0.2
483 0.2
484 0.24
485 0.3
486 0.35
487 0.37
488 0.43
489 0.48
490 0.53
491 0.57
492 0.6
493 0.63
494 0.65
495 0.68
496 0.64
497 0.57
498 0.53
499 0.49
500 0.43
501 0.35
502 0.29
503 0.25
504 0.22
505 0.21
506 0.19
507 0.15
508 0.14
509 0.14
510 0.13
511 0.12
512 0.12
513 0.12
514 0.16
515 0.24
516 0.24
517 0.23
518 0.23
519 0.23
520 0.22
521 0.21
522 0.18
523 0.16
524 0.15
525 0.17
526 0.16
527 0.15
528 0.15
529 0.14
530 0.12
531 0.07
532 0.06
533 0.05
534 0.06
535 0.05
536 0.06
537 0.08
538 0.09
539 0.1
540 0.09
541 0.1
542 0.11
543 0.13
544 0.13
545 0.12
546 0.12
547 0.13
548 0.14
549 0.14
550 0.12
551 0.1
552 0.11
553 0.13
554 0.13
555 0.13
556 0.13
557 0.15
558 0.17
559 0.17
560 0.16
561 0.14
562 0.13
563 0.12
564 0.12
565 0.1
566 0.08
567 0.08
568 0.08
569 0.07
570 0.07
571 0.06
572 0.06