Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FT97

Protein Details
Accession A0A5C5FT97    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-129RERMTRTKATKGKRGKRRWEMRSGAGBasic
NLS Segment(s)
PositionSequence
104-123RERMTRTKATKGKRGKRRWE
Subcellular Location(s) nucl 8, plas 5, extr 5, cyto_nucl 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVRRQPVPRHDDFLSESDLSPSSGEDDPATSAAPRPYSAVRERASSTPGAATRRPYRDRDDTSTSSGDGAERKTRSEAGAPPVLGLSDEDSTDEDEEKLIGGGRERMTRTKATKGKRGKRRWEMRSGAGAAAPAQTSGGGSNTGAIVIGIVVFVLVVCGVGGYYAYTQGMFDSIAGSSDSSSTSAGTSGAVAGRTTAPAAAGATGTTGAGTTGGVSAATSAQSSGAAGSAASSGSASGSGSATASGSTASSGSASSDASASSSSDSATESGATESGDATELPDIFQTVMSKVKSAGEENKDDKETGINNDMPRLDSETLVTTIDGKETTVRGLWKTELLGGSTPTSSFLVIDAGGEKRRRGLSWPAPTAPPVLRKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.31
4 0.27
5 0.27
6 0.23
7 0.19
8 0.16
9 0.15
10 0.14
11 0.14
12 0.13
13 0.13
14 0.14
15 0.15
16 0.15
17 0.12
18 0.15
19 0.17
20 0.18
21 0.18
22 0.2
23 0.22
24 0.29
25 0.34
26 0.38
27 0.36
28 0.39
29 0.42
30 0.41
31 0.41
32 0.35
33 0.31
34 0.28
35 0.3
36 0.31
37 0.3
38 0.35
39 0.4
40 0.49
41 0.53
42 0.52
43 0.56
44 0.61
45 0.66
46 0.66
47 0.65
48 0.6
49 0.6
50 0.56
51 0.48
52 0.39
53 0.32
54 0.26
55 0.21
56 0.21
57 0.23
58 0.22
59 0.24
60 0.26
61 0.27
62 0.28
63 0.3
64 0.31
65 0.3
66 0.34
67 0.32
68 0.3
69 0.28
70 0.26
71 0.21
72 0.16
73 0.12
74 0.08
75 0.08
76 0.08
77 0.09
78 0.1
79 0.11
80 0.11
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.08
89 0.12
90 0.14
91 0.19
92 0.21
93 0.25
94 0.27
95 0.33
96 0.36
97 0.41
98 0.46
99 0.48
100 0.56
101 0.63
102 0.69
103 0.73
104 0.8
105 0.81
106 0.85
107 0.88
108 0.86
109 0.85
110 0.8
111 0.74
112 0.69
113 0.6
114 0.5
115 0.4
116 0.33
117 0.23
118 0.19
119 0.14
120 0.08
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.03
134 0.03
135 0.03
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.04
185 0.04
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.04
219 0.03
220 0.03
221 0.03
222 0.04
223 0.03
224 0.04
225 0.04
226 0.04
227 0.04
228 0.05
229 0.05
230 0.04
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.07
249 0.07
250 0.06
251 0.07
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.08
259 0.07
260 0.07
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.07
267 0.07
268 0.07
269 0.07
270 0.08
271 0.07
272 0.09
273 0.09
274 0.09
275 0.14
276 0.14
277 0.14
278 0.15
279 0.17
280 0.18
281 0.22
282 0.28
283 0.29
284 0.36
285 0.38
286 0.42
287 0.4
288 0.39
289 0.35
290 0.31
291 0.28
292 0.26
293 0.28
294 0.28
295 0.27
296 0.3
297 0.3
298 0.27
299 0.26
300 0.27
301 0.23
302 0.19
303 0.2
304 0.19
305 0.19
306 0.18
307 0.17
308 0.13
309 0.12
310 0.13
311 0.12
312 0.1
313 0.12
314 0.12
315 0.14
316 0.15
317 0.17
318 0.18
319 0.21
320 0.22
321 0.21
322 0.22
323 0.24
324 0.22
325 0.21
326 0.21
327 0.2
328 0.2
329 0.18
330 0.17
331 0.16
332 0.15
333 0.13
334 0.12
335 0.1
336 0.1
337 0.09
338 0.1
339 0.1
340 0.13
341 0.19
342 0.22
343 0.22
344 0.26
345 0.3
346 0.3
347 0.33
348 0.4
349 0.45
350 0.53
351 0.59
352 0.57
353 0.56
354 0.56
355 0.56
356 0.5
357 0.49