Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5G1P3

Protein Details
Accession A0A5C5G1P3   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-89MELIRNSKDKKARKLTKKRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
64-87NSKDKKARKLTKKRLGTLRRAKRK
Subcellular Location(s) cyto 6, cyto_nucl 6, mito 15, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MATPRTNLPWGLNKGHPTTVIAKVPKPSNRKGRQSARSAFVKSIVREVAGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELTGVIAEQRRHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.39
4 0.33
5 0.33
6 0.33
7 0.34
8 0.32
9 0.32
10 0.36
11 0.42
12 0.46
13 0.48
14 0.51
15 0.56
16 0.62
17 0.69
18 0.73
19 0.76
20 0.76
21 0.79
22 0.75
23 0.7
24 0.65
25 0.58
26 0.49
27 0.43
28 0.39
29 0.31
30 0.29
31 0.23
32 0.19
33 0.17
34 0.18
35 0.14
36 0.11
37 0.1
38 0.08
39 0.11
40 0.11
41 0.12
42 0.11
43 0.1
44 0.1
45 0.12
46 0.17
47 0.2
48 0.26
49 0.29
50 0.35
51 0.36
52 0.41
53 0.49
54 0.51
55 0.54
56 0.59
57 0.65
58 0.71
59 0.81
60 0.86
61 0.88
62 0.89
63 0.87
64 0.86
65 0.84
66 0.84
67 0.84
68 0.83
69 0.84
70 0.81
71 0.77
72 0.74
73 0.75
74 0.71
75 0.67
76 0.61
77 0.52
78 0.51
79 0.47
80 0.4
81 0.34
82 0.31
83 0.24