Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4TWH4

Protein Details
Accession G4TWH4   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-78QAKAEKIVKKNWKKDKQLNSNYQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences CSLTASQDRSNIARRALCGXFCHAKSDLELHFRSCQSCPTATSYQNQCSPCDGVLQAKAEKIVKKNWKKDKQLNSNYQAVEIHYYANSGSHIHAMYFTADGHRVTVSYLYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.36
4 0.33
5 0.33
6 0.33
7 0.29
8 0.3
9 0.3
10 0.25
11 0.24
12 0.27
13 0.23
14 0.26
15 0.26
16 0.24
17 0.27
18 0.27
19 0.27
20 0.25
21 0.25
22 0.22
23 0.22
24 0.21
25 0.24
26 0.27
27 0.27
28 0.33
29 0.34
30 0.35
31 0.4
32 0.39
33 0.33
34 0.31
35 0.3
36 0.24
37 0.2
38 0.17
39 0.13
40 0.14
41 0.15
42 0.13
43 0.12
44 0.14
45 0.15
46 0.17
47 0.18
48 0.24
49 0.33
50 0.41
51 0.51
52 0.6
53 0.67
54 0.74
55 0.81
56 0.83
57 0.84
58 0.85
59 0.84
60 0.77
61 0.74
62 0.65
63 0.56
64 0.46
65 0.36
66 0.29
67 0.21
68 0.17
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.08
75 0.09
76 0.1
77 0.11
78 0.1
79 0.11
80 0.11
81 0.12
82 0.11
83 0.11
84 0.11
85 0.12
86 0.12
87 0.13
88 0.12
89 0.11
90 0.12