Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FQA2

Protein Details
Accession A0A5C5FQA2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
103-136RGRPRAPARPPRPLARRRRHPRPPPDPPRLGTRRBasic
NLS Segment(s)
PositionSequence
85-136RRPAATGPPRAHKVPPPGRGRPRAPARPPRPLARRRRHPRPPPDPPRLGTRR
Subcellular Location(s) cyto 3, extr 11, mito 6, nucl 7
Family & Domain DBs
Amino Acid Sequences MGILFKLVASSAAVAGAGLYLAPDLVQHRIPASAPSSPSPRPADPDQLRSRVSPPPPFPVPPSRNAHPDPVLLSTPLPGAALALRRPAATGPPRAHKVPPPGRGRPRAPARPPRPLARRRRHPRPPPDPPRLGTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.04
5 0.03
6 0.03
7 0.02
8 0.02
9 0.03
10 0.04
11 0.05
12 0.08
13 0.09
14 0.1
15 0.11
16 0.12
17 0.13
18 0.14
19 0.15
20 0.16
21 0.17
22 0.2
23 0.24
24 0.24
25 0.3
26 0.32
27 0.3
28 0.33
29 0.34
30 0.41
31 0.4
32 0.48
33 0.47
34 0.46
35 0.47
36 0.42
37 0.42
38 0.38
39 0.39
40 0.37
41 0.35
42 0.37
43 0.38
44 0.38
45 0.39
46 0.43
47 0.41
48 0.4
49 0.44
50 0.4
51 0.43
52 0.43
53 0.43
54 0.34
55 0.32
56 0.26
57 0.22
58 0.2
59 0.15
60 0.13
61 0.1
62 0.09
63 0.08
64 0.07
65 0.05
66 0.04
67 0.05
68 0.07
69 0.07
70 0.09
71 0.1
72 0.09
73 0.1
74 0.1
75 0.16
76 0.18
77 0.25
78 0.27
79 0.33
80 0.37
81 0.39
82 0.41
83 0.4
84 0.47
85 0.48
86 0.54
87 0.55
88 0.61
89 0.68
90 0.73
91 0.71
92 0.7
93 0.72
94 0.73
95 0.75
96 0.76
97 0.75
98 0.77
99 0.79
100 0.78
101 0.79
102 0.78
103 0.8
104 0.8
105 0.84
106 0.84
107 0.9
108 0.91
109 0.92
110 0.93
111 0.93
112 0.93
113 0.92
114 0.92
115 0.88
116 0.8