Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FYS0

Protein Details
Accession A0A5C5FYS0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
111-131DKNREEHEKKYGPKKSKARVDBasic
NLS Segment(s)
PositionSequence
119-128KKYGPKKSKA
Subcellular Location(s) extr 19, golg 3, mito 2, plas 1, pero 1, E.R. 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MAKHAPVSQEPSKPWLKLVVTLVILAALGYAAKLALAAINESINSAKSAMEKKGVQVSSSGASVKTNKRALTQEETEDRIQRGIMKGWKASSFNVPWALGKVSNLSGSTHDKNREEHEKKYGPKKSKARVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.33
4 0.33
5 0.34
6 0.32
7 0.28
8 0.27
9 0.25
10 0.18
11 0.17
12 0.11
13 0.08
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.03
23 0.04
24 0.04
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.09
35 0.13
36 0.13
37 0.17
38 0.17
39 0.18
40 0.25
41 0.24
42 0.21
43 0.19
44 0.19
45 0.16
46 0.17
47 0.15
48 0.08
49 0.1
50 0.14
51 0.16
52 0.2
53 0.22
54 0.22
55 0.25
56 0.27
57 0.31
58 0.33
59 0.32
60 0.3
61 0.29
62 0.32
63 0.3
64 0.3
65 0.26
66 0.2
67 0.18
68 0.16
69 0.15
70 0.17
71 0.2
72 0.2
73 0.22
74 0.23
75 0.26
76 0.25
77 0.26
78 0.27
79 0.24
80 0.25
81 0.26
82 0.25
83 0.22
84 0.23
85 0.23
86 0.17
87 0.16
88 0.15
89 0.14
90 0.15
91 0.15
92 0.14
93 0.16
94 0.22
95 0.26
96 0.3
97 0.35
98 0.36
99 0.39
100 0.45
101 0.52
102 0.5
103 0.5
104 0.54
105 0.56
106 0.62
107 0.69
108 0.71
109 0.69
110 0.75
111 0.8