Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C5FLE3

Protein Details
Accession A0A5C5FLE3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-106FLAPRRCRLNVHKRRWRRERAGEPSRBasic
NLS Segment(s)
PositionSequence
92-106HKRRWRRERAGEPSR
Subcellular Location(s) extr 14, plas 9, mito 2
Family & Domain DBs
Amino Acid Sequences MHVSSLCRGHANLLCIVPILCISHPVGWITGEVASMLTPADKEQCQLRTSGRPVDATVTVKSSLLLRSGRARCHCSDSAAFLAPRRCRLNVHKRRWRRERAGEPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.15
5 0.12
6 0.11
7 0.08
8 0.1
9 0.11
10 0.12
11 0.13
12 0.13
13 0.13
14 0.11
15 0.12
16 0.1
17 0.09
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.07
28 0.07
29 0.08
30 0.12
31 0.15
32 0.16
33 0.17
34 0.19
35 0.22
36 0.25
37 0.28
38 0.25
39 0.23
40 0.23
41 0.23
42 0.23
43 0.19
44 0.17
45 0.15
46 0.14
47 0.13
48 0.13
49 0.12
50 0.1
51 0.12
52 0.12
53 0.12
54 0.21
55 0.24
56 0.3
57 0.33
58 0.37
59 0.36
60 0.42
61 0.41
62 0.37
63 0.35
64 0.33
65 0.31
66 0.3
67 0.28
68 0.25
69 0.31
70 0.3
71 0.35
72 0.35
73 0.34
74 0.37
75 0.47
76 0.55
77 0.59
78 0.67
79 0.72
80 0.79
81 0.88
82 0.92
83 0.92
84 0.91
85 0.91
86 0.91