Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FU86

Protein Details
Accession A0A5C5FU86    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-154SSSPCRASRRSPTPRRPRPARPRQDVPRGARQRHydrophilic
157-182AAVHLDPPARRRQRQRPTRDSDRRRRBasic
NLS Segment(s)
PositionSequence
129-182SRRSPTPRRPRPARPRQDVPRGARQRQGAAVHLDPPARRRQRQRPTRDSDRRRR
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MNAARGLQLRFRFSTVSSLSSTLSVGPFAHARWPPPPSSRPGTPRPPLSSHLILSSCRPTRRLNKPHQQAAQRPHSRHQRLARTPSRSKSTSPPPLSRSTLKTTGSPATCETVTMWTRTRASSSPCRASRRSPTPRRPRPARPRQDVPRGARQRQGAAVHLDPPARRRQRQRPTRDSDRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.29
4 0.26
5 0.26
6 0.24
7 0.23
8 0.22
9 0.16
10 0.14
11 0.12
12 0.1
13 0.11
14 0.11
15 0.11
16 0.18
17 0.18
18 0.2
19 0.24
20 0.28
21 0.3
22 0.35
23 0.39
24 0.38
25 0.43
26 0.48
27 0.5
28 0.54
29 0.59
30 0.59
31 0.62
32 0.61
33 0.58
34 0.54
35 0.54
36 0.49
37 0.41
38 0.38
39 0.33
40 0.28
41 0.27
42 0.31
43 0.29
44 0.28
45 0.3
46 0.33
47 0.41
48 0.51
49 0.58
50 0.61
51 0.67
52 0.73
53 0.79
54 0.79
55 0.76
56 0.72
57 0.7
58 0.7
59 0.66
60 0.6
61 0.6
62 0.64
63 0.61
64 0.61
65 0.61
66 0.61
67 0.61
68 0.68
69 0.68
70 0.65
71 0.66
72 0.64
73 0.62
74 0.53
75 0.49
76 0.46
77 0.48
78 0.5
79 0.5
80 0.49
81 0.47
82 0.5
83 0.51
84 0.48
85 0.43
86 0.38
87 0.38
88 0.35
89 0.32
90 0.31
91 0.32
92 0.3
93 0.27
94 0.23
95 0.2
96 0.19
97 0.18
98 0.16
99 0.16
100 0.16
101 0.17
102 0.18
103 0.18
104 0.2
105 0.2
106 0.22
107 0.19
108 0.25
109 0.32
110 0.37
111 0.44
112 0.48
113 0.54
114 0.54
115 0.58
116 0.62
117 0.63
118 0.67
119 0.68
120 0.74
121 0.79
122 0.86
123 0.9
124 0.89
125 0.89
126 0.89
127 0.9
128 0.9
129 0.87
130 0.87
131 0.86
132 0.88
133 0.86
134 0.81
135 0.81
136 0.79
137 0.74
138 0.69
139 0.63
140 0.57
141 0.54
142 0.5
143 0.42
144 0.39
145 0.36
146 0.33
147 0.33
148 0.32
149 0.28
150 0.29
151 0.36
152 0.4
153 0.47
154 0.55
155 0.63
156 0.71
157 0.8
158 0.87
159 0.87
160 0.88
161 0.91
162 0.92