Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C5FMS1

Protein Details
Accession A0A5C5FMS1   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-80PWLATRPPSRHPRRRRVAPRRAARPSSHydrophilic
NLS Segment(s)
PositionSequence
59-89RPPSRHPRRRRVAPRRAARPSSPTGPPSTRH
Subcellular Location(s) cyto 1.5, cyto_nucl 7.5, mito 11, nucl 12.5
Family & Domain DBs
Amino Acid Sequences LLPLTRSLQLLPRKNPAPTPSPSPAPSLPSEASLAPSGVLPKPLSAPLLALLRPWLATRPPSRHPRRRRVAPRRAARPSSPTGPPSTRHVPPPPSPPSSHDRRSPPLTPSSDPAPLRPRSTKQPSSAPRRPTPTARSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.54
4 0.5
5 0.46
6 0.49
7 0.46
8 0.47
9 0.46
10 0.45
11 0.42
12 0.4
13 0.37
14 0.34
15 0.3
16 0.26
17 0.26
18 0.21
19 0.21
20 0.18
21 0.16
22 0.11
23 0.11
24 0.12
25 0.11
26 0.13
27 0.11
28 0.11
29 0.12
30 0.13
31 0.13
32 0.11
33 0.11
34 0.11
35 0.13
36 0.12
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.14
45 0.19
46 0.24
47 0.31
48 0.41
49 0.51
50 0.6
51 0.68
52 0.74
53 0.77
54 0.83
55 0.87
56 0.87
57 0.88
58 0.87
59 0.86
60 0.84
61 0.82
62 0.75
63 0.66
64 0.6
65 0.54
66 0.49
67 0.43
68 0.36
69 0.34
70 0.32
71 0.32
72 0.33
73 0.34
74 0.32
75 0.35
76 0.39
77 0.4
78 0.42
79 0.49
80 0.48
81 0.46
82 0.46
83 0.45
84 0.45
85 0.47
86 0.48
87 0.47
88 0.48
89 0.51
90 0.55
91 0.55
92 0.52
93 0.53
94 0.52
95 0.47
96 0.45
97 0.42
98 0.43
99 0.4
100 0.41
101 0.41
102 0.4
103 0.44
104 0.47
105 0.48
106 0.51
107 0.6
108 0.62
109 0.6
110 0.67
111 0.7
112 0.74
113 0.77
114 0.75
115 0.73
116 0.74
117 0.74
118 0.72